CAZyme Information: MGYG000000157_00744

Basic Information

• Species: Paraclostridium sordellii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium sordellii
• CAZyme ID: MGYG000000157_00744
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		22391.02	9.7597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000157	3456733	Isolate	China	Asia

• Gene Location: Start: 16505; End: 17074 Strand: +

Full Sequence      

MNKKRFIMVFIVFVLLVLGSICVREKLVLKLFHPKFYEEYVSRYSKEFKVDENLVYSIMK
VESKFNKNAVSKRNAKGLMQISDITQKWAIDELKLKEVDIFDPETNIKIGCWYLSKLFKE
FKDVDLVVAAYNGGSGNVNKWLNNSDYSYDGNQLHKIPFNETKNYLKKVKDNYIMYKSLY
RKEESNEKN

Enzyme Prediction     

No EC number prediction in MGYG000000157_00744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	177	1.5e-31	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.98e-67	34	173	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.88e-45	34	179	3	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	2.21e-39	34	180	136	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	2.84e-38	52	173	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	7.02e-36	39	174	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEK37012.1	4.09e-131	1	189	1	189
CEJ72538.1	1.17e-130	1	189	1	189
QYE98471.1	1.13e-128	1	189	1	189
AUN15937.1	9.85e-126	8	189	1	182
QEZ70692.1	1.26e-97	15	189	2	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.89e-15	37	180	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.90e-15	37	180	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.92e-15	37	180	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.93e-15	37	180	430	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.94e-15	37	180	436	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.35e-13	34	181	477	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	7.97e-13	34	181	477	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	7.97e-13	34	181	477	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31608	3.44e-12	41	173	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.96e-11	37	173	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.401520	0.364127	0.227807	0.001202	0.000979	0.004355

TMHMM  Annotations     

start	end
7	24