CAZyme Information: MGYG000000157_02071

Basic Information

• Species: Paraclostridium sordellii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium sordellii
• CAZyme ID: MGYG000000157_02071
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000157_56|CGC1	40681.55	9.3979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000157	3456733	Isolate	China	Asia

• Gene Location: Start: 3319; End: 4359 Strand: +

Full Sequence      

MKKSILIIITLLIIIGIFFIGKNTTKNIDVKEKIKSVNLSTDYYIEQVLKDVNDLNANTV
NVPIVINIENLNSNNIKIDDSSKRKAIELIKVLKSKNIKVILEAYPWIDNGSKYETDYNP
KNKERFFKDWEHILDTLIKEIGNKYDVDILIVASNFSKLEIYEDNWCDIVKFVKNRFNGA
VTYKTSWWYTATWDKKSKENYYKKLNNKVFSKVDFISIAAYFELSDKKENTVKELINCLS
STTIYNRQQNVVKEINNFYEKYNKEIYFAELGFPRKDNAATQPWNSQVSNIENNKEQARC
FKAYKDVFQDKKYIKGFSVFAVGEKGNDKYFYPSKESIEVISDWYK

Enzyme Prediction     

No EC number prediction in MGYG000000157_02071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	41	325	4.1e-46	0.869281045751634

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	1.15e-53	33	345	2	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	2.40e-14	87	344	66	289	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUN14854.1	3.76e-244	1	346	1	346
CEK38658.1	5.11e-242	1	346	1	346
CEJ74170.1	9.88e-240	1	346	1	346
CEI73267.1	1.66e-192	1	345	1	345
QEZ70749.1	8.84e-150	1	346	3	345

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.546826	0.329406	0.119518	0.000810	0.000597	0.002840

TMHMM  Annotations     

start	end
4	21