CAZyme Information: MGYG000000158_00141

Basic Information

• Species: Collinsella sp003436275
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003436275
• CAZyme ID: MGYG000000158_00141
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000000158_1|CGC2	58839.01	4.7336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000158	2308547	Isolate	China	Asia

• Gene Location: Start: 159918; End: 161495 Strand: -

Full Sequence      

MANALQRDLMQLVKAAEDAASRRPRTWAQTYHLMPPVGWLNDPNGLYQKDGVFHAYFQYA
PFDVEGGVKMWGHSTSSDLVSWTYEGCALYPDEPFDCHGVYSGSALVLDDHVSVFYTGNV
KLPDGNGAYDYINTGREGNTVMVDTADGETFGEKRLLLGNADYPADLSCHVRDPKVWRAD
APCGRYLMVLGARRRGAAEEAGPAKDSVPASPSPRRELFVRCHGASCERDAGEVLVYASD
ELQTWRLQNRIQSSERFGFMWECPDYFELDALQVLSFSPQGLFGGDWEHRNVYHSGYVPF
AGDICGRYELGTFRLWDAGFDFYAPQTFVAEDGRRILMGWMGMPEDATYGNDPTIVEGWQ
HCFTVPRELTAGNGGVVLQRPVRELASLRGQAHRAVDELHLDVIPTACDIALEDVGDEMH
VVLGEELELFVTCDPDERLMRFVMRFRDAGRNAASCGRTERWERVNAVRSVRILVDTSSV
EVFVNEGELVMSTRWYPRSRSCAIRVPGARITCWELSANGEKGEL

Enzyme Prediction     

No EC number prediction in MGYG000000158_00141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	32	195	1.6e-42	0.5119453924914675
GH32	226	381	5.8e-36	0.4948805460750853

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.51e-140	38	370	1	286	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	6.36e-129	27	497	13	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.47e-112	7	506	4	468	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	7.70e-98	32	381	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.00e-96	32	487	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33159.1	3.53e-200	1	517	1	512
SDR64968.1	3.35e-188	1	517	1	482
AEB06470.1	1.38e-183	1	504	1	515
ADK67558.1	6.90e-170	1	518	1	482
CCG34775.1	9.13e-169	3	516	2	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.67e-57	14	499	12	461	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	4.27e-48	16	494	38	458	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
3PIG_A	3.07e-47	8	506	20	495	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7BWC_A	5.76e-47	16	494	38	458	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	1.35e-46	20	506	32	495	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	8.15e-88	5	497	8	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	7.73e-76	31	497	30	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	1.08e-74	15	501	11	453	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	6.03e-74	22	498	19	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
A1STJ9	2.58e-71	31	517	99	537	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000158_00141.