CAZyme Information: MGYG000000158_01936

Basic Information

• Species: Collinsella sp003436275
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003436275
• CAZyme ID: MGYG000000158_01936
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		34926.18	4.7075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000158	2308547	Isolate	China	Asia

• Gene Location: Start: 5991; End: 6947 Strand: -

Full Sequence      

MAFVACALAVAQLLSALFGFWDDAASKQGLEGLPPYITYEMVEAALECQEEYGHPAGCTI
AQIIQESGQGDRMSQLAERDHNLFGMKWWSGYAGCPEVAGKANWATSEEYVPGEHTQITA
SFIRFTGDAECIRFRSRVFLQAERYSGNALIREAIERHDSDRMAEGLKDAGWATDSSYVE
SLKSIMAQWGLYRLDSMTVEDLKDPAANGNAIVEAAYSQLGVPYVWGGSTPGKALDCSGL
TQYCYAQAGIRISHYTGSQYEELRRIPLSEAKPGDILYRSGHVAIYIGDDRYIHEPRTGD
MCRIASGIGSFSCALTAR

Enzyme Prediction     

No EC number prediction in MGYG000000158_01936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	191	3.2e-25	0.9921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	1.77e-25	221	299	1	84	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	3.26e-23	204	307	70	182	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
COG1705	FlgJ	4.72e-23	40	195	49	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF033741	NlpC_p60_RipA	9.15e-22	216	305	335	440	NlpC/P60 family peptidoglycan endopeptidase RipA.
NF033742	NlpC_p60_RipB	1.80e-20	196	299	60	183	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34838.1	9.85e-234	2	318	208	524
ATP54961.1	2.68e-231	2	318	208	524
CBL05254.1	1.34e-167	2	318	209	525
AJC12020.1	2.35e-166	2	315	212	525
AWG17013.1	4.72e-166	2	315	212	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	1.53e-18	206	306	25	130	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
2XIV_A	1.50e-17	212	305	83	192	Structureof Rv1477, hypothetical invasion protein of Mycobacterium tuberculosis [Mycobacterium tuberculosis H37Rv]
3NE0_A	1.65e-17	212	305	88	197	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	1.65e-17	212	305	88	197	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3S0Q_A	3.00e-16	212	305	89	198	ChainA, INVASION PROTEIN [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	6.13e-16	206	306	399	504	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
A0QX22	7.97e-16	212	305	371	480	Peptidoglycan endopeptidase RipA OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ripA PE=1 SV=1
O53168	1.01e-15	212	305	346	455	Peptidoglycan endopeptidase RipA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ripA PE=1 SV=1
P67474	2.68e-14	211	304	275	370	Probable endopeptidase Mb2213c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2213C PE=3 SV=1
P9WHU3	2.68e-14	211	304	275	370	Probable endopeptidase Rv2190c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2190c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.901887	0.097038	0.000652	0.000182	0.000092	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000158_01936.