CAZyme Information: MGYG000000159_00810

Basic Information

• Species: Sellimonas intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Sellimonas; Sellimonas intestinalis
• CAZyme ID: MGYG000000159_00810
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000000159_2|CGC2	84557.07	5.0252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000159	3206639	Isolate	China	Asia

• Gene Location: Start: 184028; End: 186250 Strand: +

Full Sequence      

MEKEQIIEKDLDAIYIGNLNTVDENLKLPLEGKYGSTFTWDTGESRFIEKDGTVHRPLHG
MGNRKVILTVKALYGGCTGERVFTATVLQEAKEKTVTEIRPVSLVAETGHSYRLPSVVIV
HTAQGSQTTVPVIWEEAEILEREGMVEVEGKIEDSEKKALARITFRDHVEKKKGEEKKIR
FFPISDVRLKKGTLYQKYQQYMLDWLLGVDDGQMLYNFRKAAGLDTCGAAPMTGWDEESC
KLKGHTTGHYLSGLALAYAATGDTRFREKIGEMVTGLKECQDAFQGQKGIHPGFLSAYDE
EQFDLLEQYTKYPEIWAPYYTLDKIMAGLEDCYLLAEADMALEILSPLGDWVYARLSRLT
REQREKMWSMYIAGEFGGMSGTMAKLYQITKKPEHLEAARMFYNEKLYYPMEENCDTLED
MHANQHIPQVIGAMNLYETTGETSFFDVGRHFWEIVTEGHIYCIGGTGETEMFHRAGTTC
DYLTEKAAESCASYNMLRLTGQLFEYNPDGRWMDYYENTLCNHILASSSHAVDGGTTYFM
PLCPGGRKEYSTDENTCCHGTGMESRFRYMEHIYASDQENVYVNLMVDSVLSGEENLEIS
TEMEKGSVVIRCGKDMERNLMIHLPFWGRDARVFRNQMEQKVKQHQGYVQLSPCRKGEEI
RLELPVRLRLVTNEENDHLVNLACGPYLLAAISDSREFLELPPLDQFRPDGQPFHFMAKG
LKFVPFPEVDLEPAHLYFKR

Enzyme Prediction     

No EC number prediction in MGYG000000159_00810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	187	690	2.1e-158	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.34e-107	186	690	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.82e-65	187	704	12	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07532	Big_4	2.20e-08	99	155	1	59	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT48731.1	0.0	1	740	1	746
ADK83263.1	5.58e-237	2	739	9	756
AET60941.1	5.95e-232	5	739	15	764
ASR47498.1	3.58e-226	5	739	15	764
ASA19572.1	1.05e-224	8	739	18	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.09e-70	179	690	25	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	7.11e-65	179	690	25	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5HO0_A	6.63e-07	4	92	553	643	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]
5HO9_A	1.35e-06	4	88	553	637	Structureof truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus],5HO9_B Structure of truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000159_00810.