CAZyme Information: MGYG000000161_00525

Basic Information

• Species: Lactobacillus amylovorus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus amylovorus
• CAZyme ID: MGYG000000161_00525
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	MGYG000000161_10|CGC1	49856.2	9.5625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000161	2049624	Isolate	China	Asia

• Gene Location: Start: 20709; End: 22016 Strand: +

Full Sequence      

MSDVMQIITLISIWLSLLMSMVTLSGAIAFWLKHSKVLVKITPLPRYPKVTIVVPAHNEE
LVIKNTATAILNLNYPKDKLEVLFYADNCEDHTADVLDSVLAEERFKNRNAKVIRRTGTG
GKAGVLNDALKIAHGEYLGVYDADAMPESNALYFLVRKVLENPKRYMAAFGRNKTRNAKQ
NFLTRCINQEIVVTQRIQHCGIWQLFKIGRIPGTNFIINKEYVESIGGWRNGALTEDTDI
SFKIMGSGKLIALAYNSEAFQQEPERLKDYYFQRLRWAKGNYEVVINNFKHLFDRSNWRV
KLETFYYSCTFFWFNAAIILSDIIFLANVIAMIVHIWQPGVQLPFTITSSNILLAQILLL
NWLLMILLYILQIYAAMCTQFGQATTGQIWLALASYFSYSQLFIVVSVHAVCSVTADRLF
HRDSTKWIKTKRFAD

Enzyme Prediction     

No EC number prediction in MGYG000000161_00525.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	48	278	9.2e-22	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	3.52e-51	52	237	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.34e-46	1	357	5	357	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.70e-40	17	354	19	341	N-glycosyltransferase; Provisional
PRK14583	hmsR	5.87e-31	17	330	39	348	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06421	CESA_CelA_like	4.39e-30	48	284	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ58124.1	3.84e-314	1	435	1	435
AUX15165.1	1.10e-313	1	435	1	435
ADZ06291.1	3.15e-313	1	435	1	435
QDD69566.1	4.47e-313	1	435	1	435
AEA31102.1	9.03e-313	1	435	1	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.42e-15	43	284	264	504	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	5.20e-08	41	146	34	138	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.22e-08	41	146	35	139	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	4.66e-07	43	314	117	406	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.81e-07	43	314	129	418	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.38e-64	1	433	1	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	1.15e-23	48	283	106	336	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.55e-23	48	283	106	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	1.68e-23	47	305	107	361	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8XAR5	5.75e-20	19	313	41	332	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000039	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
10	32
312	334
354	376
389	411