CAZyme Information: MGYG000000161_01974

Basic Information

• Species: Lactobacillus amylovorus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus amylovorus
• CAZyme ID: MGYG000000161_01974
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		40015.52	10.1168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000161	2049624	Isolate	China	Asia

• Gene Location: Start: 543; End: 1604 Strand: +

Full Sequence      

MKKVVIAIPYLTGKGGTETVIKNFAEALDVKNTDDNISWKLVSFGGTKYPEWLSGWNKKV
YNFTQSRCIQLMAYAILMPFLIAHIFKKEKPDFFIATNPIIWSIAFAERNVFSKKTKIGA
WYHYSFKMKNVKEKYLKKADFFWAISSGIKDELLSLGVSPDKIYVIYNPVDVDHVTAVKR
SGKQNRFIYIGRIDYDGQKNVSELIKALNKVKGDWHCDLYGSVDPETKDRLLRLANDHTK
SQIEFKGFYKDVWNQIKKADVLILTSKFEGLPMTLIEAAARGISLISSNCPVGPDNIVTS
QNGFLYKTGDINNLSAIITRIVGKEIVLPSSKNTSKSISKFGYKAFSDRILVK

Enzyme Prediction     

No EC number prediction in MGYG000000161_01974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	183	324	5e-22	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09922	PRK09922	1.06e-69	2	350	1	349	lipopolysaccharide 1,6-galactosyltransferase.
cd03811	GT4_GT28_WabH-like	1.43e-46	3	321	1	325	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	3.51e-39	3	316	1	314	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03808	GT4_CapM-like	3.93e-31	80	322	71	327	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
COG0438	RfaB	2.77e-30	1	321	1	339	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX70916.1	9.93e-217	1	350	1	350
ABX27665.1	2.84e-216	1	346	1	346
AZZ67743.1	1.26e-166	1	352	1	352
QGT97866.1	1.39e-163	1	352	1	352
AYN48694.1	1.76e-154	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N7Z_A	6.95e-34	11	326	10	326	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	7.09e-34	11	326	11	327	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	7.22e-34	11	326	12	328	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
7EC2_A	2.67e-10	161	314	292	449	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
2JJM_A	1.19e-06	136	315	154	341	CrystalStructure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27127	1.90e-36	87	350	81	347	Lipopolysaccharide 1,6-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaB PE=3 SV=2
Q06994	3.81e-33	11	326	10	326	Lipopolysaccharide 1,6-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaB PE=1 SV=2
Q46634	1.24e-11	154	325	147	320	Amylovoran biosynthesis glycosyltransferase AmsD OS=Erwinia amylovora OX=552 GN=amsD PE=3 SV=2
Q9R9N1	4.13e-09	55	351	41	333	Lipopolysaccharide core biosynthesis glycosyltransferase LpsE OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsE PE=3 SV=1
O05083	7.91e-08	1	314	1	312	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
68	86