CAZyme Information: MGYG000000162_00017

Basic Information

• Species: Enterococcus_B durans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B durans
• CAZyme ID: MGYG000000162_00017
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000000162_1|CGC1	38244.27	9.2576

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000162	3083618	Isolate	China	Asia

• Gene Location: Start: 15191; End: 16216 Strand: -

Full Sequence      

MKKIVFTGGGTAGHVTLNTLLIPHFLKEKYSVFYIGSIDGIEKEIISENINVQYFGIETG
KYRRYLTLKNFKDIFKVVKGFFQARKILRELRPNLVFSKGGFVSVPVVLAAKTLKIRVLI
HESDLSLGMANKIGYQCCDEAFSTFPLNLKKSTRVGSLISSSDSKKDKLGTRLTLDKNKK
TVLFIGGSQGAAIFNRFVLENQSSLRIKYNVVLISGPGNTECYEDSLICIPYVKKGLGEL
FELADYVVTRGGSNTIFELLAKGKKMIIVPLNAESSRGDQIENAKYFEDQGYSVTLSESD
LTKEQLDKKIDELDARIEPIDSSNEFMEIEDFYTTILKNKI

Enzyme Prediction     

No EC number prediction in MGYG000000162_00017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	181	315	2.3e-29	0.8662420382165605

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	8.39e-110	1	313	1	321	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	2.25e-86	2	314	1	322	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	2.03e-84	1	313	1	322	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	1.30e-83	3	318	1	326	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.19e-73	2	313	1	318	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV94276.1	6.15e-236	1	341	1	341
ABV10106.1	2.08e-97	1	341	1	351
QGS45000.1	2.08e-97	1	341	1	351
VEE20734.1	2.08e-97	1	341	1	351
VTS78313.1	2.94e-97	1	341	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.33e-21	2	308	10	328	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	3.16e-21	2	302	7	311	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	6.26e-19	3	312	4	320	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AW15	4.15e-98	1	341	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=murG PE=3 SV=1
Q8DVE2	1.86e-92	2	337	4	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=murG PE=3 SV=1
A3CLN6	6.39e-92	1	336	1	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=murG PE=3 SV=1
Q8CX15	1.93e-91	2	310	3	318	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) OX=208435 GN=murG PE=3 SV=1
Q3K2P3	1.93e-91	2	310	3	318	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000162_00017.