CAZyme Information: MGYG000000162_00268

Basic Information

• Species: Enterococcus_B durans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B durans
• CAZyme ID: MGYG000000162_00268
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000000162_3|CGC1	23375.47	6.0097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000162	3083618	Isolate	China	Asia

• Gene Location: Start: 62680; End: 63294 Strand: -

Full Sequence      

MAKKKWKKQKRKNVRIIAVVLGGILIMMAFVLSLRSLSTPFSDQPQETEAKSHQQFIDQL
APHAKELQNGYGILPSIILGQAILESNWGKSTLASEYHNLFGIKAYGDQKKVNLETKEYV
NEEWITIQGDFRVYDSWEQSMDDHTQLFVNGVDWNPALYEKVITATNYREAAQALQDAGY
ATDPTYAQKIIQVIETYHLDQYDQ

Enzyme Prediction     

No EC number prediction in MGYG000000162_00268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	61	199	8.4e-41	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.15e-75	16	204	9	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.08e-41	48	203	315	472	amidase domain-containing protein.
smart00047	LYZ2	7.27e-41	46	203	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	1.65e-39	32	194	127	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK05684	flgJ	3.48e-38	52	196	151	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKX86798.1	2.96e-145	1	204	1	204
QCJ64313.1	2.96e-145	1	204	1	204
ASV95950.1	2.96e-145	1	204	1	204
QED59308.1	2.96e-145	1	204	1	204
AKZ48156.1	2.96e-145	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.14e-26	54	203	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	4.37e-23	42	203	49	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.27e-20	54	194	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.27e-20	54	194	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	1.62e-19	56	195	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.46e-47	1	204	1	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	1.62e-26	47	203	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.13e-25	47	203	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	4.16e-25	47	203	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q2G222	4.15e-22	42	203	309	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000007	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
13	32