CAZyme Information: MGYG000000162_02958

Basic Information

• Species: Enterococcus_B durans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B durans
• CAZyme ID: MGYG000000162_02958
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000000162_123|CGC1	40071.16	4.6526

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000162	3083618	Isolate	China	Asia

• Gene Location: Start: 3098; End: 4123 Strand: +

Full Sequence      

MTKFEQLAEQAQNSIDYFYLSKDKKQWLNNVYPLTDQAQNETFHYWWMAHLIDVRIDAYL
RTKNEEYLRLAEETYRYNKERNNGTLLHEYYDDMLWNALAALRLYQQTNKQVYLADAREV
CLDIFDTAWNDQMDGGFAWKRTQLDYKNTPVNGPIMILALRLYQIEENPIYLEMSKKTLA
WMKKTLVQEDSKFVEDGVNRNGDGKIDYQWKFTYNQGVYIGALIEFYHVTKDTSYLEEAL
QCAQTSIEVLVEKGVFNDEGDGGDIGLFKGIEYRYLQLLYKETHAEFIRSFIESSCQILA
EHGKRGEYLLAYRDWLENKPESVCLSDHLSGVMALESAASL

Enzyme Prediction     

No EC number prediction in MGYG000000162_02958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	25	331	8e-77	0.8743016759776536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	5.41e-90	3	341	2	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.36e-31	44	300	33	314	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	0.001	47	179	412	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG1331	YyaL	0.002	152	265	413	521	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV95817.1	8.03e-257	1	341	1	341
QPQ28125.1	9.37e-256	1	341	1	341
AKZ48022.1	9.37e-256	1	341	1	341
AKX86667.1	9.37e-256	1	341	1	341
QCJ64449.1	2.21e-254	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	6.46e-124	3	341	2	340	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	3.87e-50	36	341	79	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.16e-48	36	341	80	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	8.79e-48	36	341	80	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	1.93e-22	36	316	29	296	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000162_02958.