CAZyme Information: MGYG000000163_01955

Basic Information

• Species: Enterococcus_C asini
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C asini
• CAZyme ID: MGYG000000163_01955
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000000163_7|CGC1	33677.32	4.4607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000163	2560364	Isolate	China	Asia

• Gene Location: Start: 10407; End: 11330 Strand: -

Full Sequence      

MASPHINNQKPDILVGQTPECDFSDLQQGIDALATLPEELSKTIFILDGEYHGQVISRLS
NVTITGVGSVRLTAGHGALEVLPSGEERGTFRTATCFIEGENVRLTNLTIENTAGPGKQA
GQAVALFNNASNATVTNCRLLGYQDTLCTGPLPPFQKDGTPFVSPIEKEISYSCQIYRNC
YISGTIDFIFGGAEAWFDHCQIHSRASEQGYITAASTPEGQETGFEFHNCYLTADDGVTN
VFLGRPWRPFAKTTFKHCRLGNHIAPCGWDNWDNPANETTTDYREIDSTPDTTNLRPDWI
TTVETND

Enzyme Prediction     

No EC number prediction in MGYG000000163_01955.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	13	293	2.2e-73	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.71e-49	3	299	72	384	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.43e-48	12	285	1	258	Pectinesterase.
PLN02773	PLN02773	1.93e-46	15	285	9	262	pectinesterase
PLN02432	PLN02432	1.40e-37	13	285	13	252	putative pectinesterase
PLN02671	PLN02671	2.33e-37	1	289	49	321	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPQ27638.1	8.10e-106	23	300	18	296
ASV95312.1	1.15e-105	23	300	18	296
BBU66736.1	2.07e-104	22	300	17	296
ALZ53106.1	2.21e-104	22	300	19	298
AON59971.1	2.21e-104	22	300	19	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.61e-30	25	286	14	262	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.17e-28	23	292	19	268	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.13e-28	23	292	19	268	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	2.98e-23	11	289	7	269	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	4.15e-20	6	265	26	285	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.48e-34	13	285	7	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	3.67e-33	2	278	71	331	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	1.44e-32	22	289	95	345	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FF77	5.64e-31	13	288	308	570	Probable pectinesterase/pectinesterase inhibitor 47 OS=Arabidopsis thaliana OX=3702 GN=PME47 PE=2 SV=1
O49298	6.55e-30	10	289	248	504	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000037	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000163_01955.