CAZyme Information: MGYG000000163_02009

Basic Information

• Species: Enterococcus_C asini
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C asini
• CAZyme ID: MGYG000000163_02009
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000000163_7|CGC3	95479.62	4.8479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000163	2560364	Isolate	China	Asia

• Gene Location: Start: 63285; End: 65780 Strand: +

Full Sequence      

MGLKWLKDSPKVIRGMSFGHPWHKGELAVAEVAEKDFYLGETPLQTKVMAYWPDGSVKWT
GHNGVVSSETELNFHQGEQLEQQAIANEKYNGIYFDNGIIKGFFPKHGEGINLLDWVQVS
GEKRLTNLHLLLQYQGKKYRSQVTGLKLEENGGEKAVIKVTGEIHIQGQCAQEFTLRFRI
YRGLAKLEIIHTVVIIKGLAYEGLGLEFTTALTGEKWNRQVKFVGDDVYSEPAQLLLSRR
FYENNPNYHLQAQGEIVKLDAEDEPMLLHGKENAIWNNFRVVQSTHRSFEMAKQTGKDYC
WLPMGDGAHYSGTLYAGGETGGVACSLENFWEKAPSEIEVSGLSHDQTKLTTWLWSPEAE
AMDFRHYSERDHMLSGYEGMEEIRSTPVGIANTSRIWIDLFSTPASNEELLALAEENQQP
AQIVANPEDYRNTGVFGYFSLPDKSNQTKTMLEEQMLALRQFYLAEVGQRSWYGFWNFGD
VMHTYDRFRHQWRYDLGGYAWQNTELVPNMWLWLDFLRTGDAEVYYFAENMTRHTSEVDQ
YHAGEYKGLGSRHNVLHWGCQAKEVRISMAGLHRYYYYLTGDERIGEIMEQVKDNEEYAF
DELPPMREFMERDGQKIPVRVGPDWSALVSNWFTQWERTGDQVYLQKILTGIDCLKRSPN
RLLSGPITMFDPEKKTLDYLGTGLTGGYHMVISFGAPQVWTELAMNLEDDEWSDMVAEFG
WMYSLSPEDKEHYSEGLLKEPNFSWPMFATTMMAYGAVQRNDQKISQRAWDLLLQNDLSG
MALPVADSRQAVATWQKVSEMPWISTNVVSQWCLNVICCLDLIGDEMKEEN

Enzyme Prediction     

No EC number prediction in MGYG000000163_02009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	3	827	2e-271	0.9965197215777262

CDD Domains     

MGYG000000163_02009 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGN30572.1	0.0	1	831	1	832
AYJ44994.1	0.0	1	831	1	832
AUJ86493.1	0.0	1	831	1	832
AVC42156.1	0.0	1	831	1	832
ATF71275.1	0.0	1	831	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	2.91e-112	5	829	12	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	3.00e-111	5	829	12	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	3.13e-111	5	829	12	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	1.13e-110	5	829	12	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	6.20e-264	3	827	4	846	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000163_02009.