CAZyme Information: MGYG000000163_02133

Basic Information

• Species: Enterococcus_C asini
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C asini
• CAZyme ID: MGYG000000163_02133
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000000163_8|CGC1	42209.23	4.8151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000163	2560364	Isolate	China	Asia

• Gene Location: Start: 53635; End: 54750 Strand: +

Full Sequence      

MLEIVEVQSKTVQKALDKVVNQLISLDQVDGKEFEALSVKEQQKIGFFSRDFGMKHWDWP
QGIGLFGLSQFGSKYDSYIKSWAEEELSKGLPLPNINTICPLLTLMDYPEYEELCLKWVD
EIISNFDRTKKNGFQHNTTGLTKDSLTKNPEQLWADTVFMTVLFLTKMGRKYQNQTWLDE
ATYQVLLHTTYLFDRSEGLFYHGWDFNSNDNVGNIFWCRGNSWLTMGIPIFIDYMGDLLA
VGVRQYLIEIYKSQVESLVKIQDNSGLWHTILDDSKSYLETSGSAGIIAGIYYGMSNGYL
EKAIYQPICEKSISSLIKKIDTDGTVLNVSAGTCISRNKNDYKNIIIKPMAYGQALMICA
LGQALLYGEGE

Enzyme Prediction     

No EC number prediction in MGYG000000163_02133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	362	2.2e-81	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.10e-80	55	366	32	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.01e-77	51	361	20	336	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF55989.1	2.42e-142	11	367	4	362
AQR94730.1	2.42e-142	11	367	4	362
QGR82105.1	6.37e-130	19	361	3	355
QCT90693.1	2.57e-129	19	361	3	355
QOG28348.1	2.57e-129	19	361	3	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	4.06e-62	53	365	61	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.81e-60	53	365	62	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	4.21e-50	53	361	43	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	1.43e-15	153	335	199	376	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5NOA_A	1.62e-13	154	312	158	320	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.33e-46	48	365	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	6.89e-15	154	326	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	9.05e-12	154	326	159	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000163_02133.