CAZyme Information: MGYG000000164_01970

Basic Information

• Species: Mediterraneibacter_A butyricigenes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter_A; Mediterraneibacter_A butyricigenes
• CAZyme ID: MGYG000000164_01970
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000000164_5|CGC4	46908.9	6.1243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000164	3102552	Isolate	China	Asia

• Gene Location: Start: 256421; End: 257662 Strand: -

Full Sequence      

MKKIAIITMGVKLKGEKGYTRFGYLAEFLTKAGFQVDLITTSFQHWEKAQRDLQKIQEDI
KAGEYPFGLRFIYEPGYKKNVDLARIRSHRIAAKNLQKMLEAKPEDGKDYDLLYAEIPPN
DVARVAAEYGAAHNIPFVADVNDLWPEAMRMVLDVPVVSDILFHPLQRDAEKVYSLVSGV
VGTSDEYRDRPFKNQKRNVPKITVYVGNEIEAFDKGAEENKELVPKREGEFWVSYAGTIG
TSYDIRTMVLAGEELVRRGHPEIKIKILGGGPMKEELEELANTRQIYNVEFVGYAPYGKM
AAYLKQSDVLVNSFVKKAPQSIVTKIGDYLAAGKAMINTCMSPEFREKVEADGFGVNIMP
EDVKILADAIEDLYEKEEKRLEMGRKARQIAEEQFDRPKAYQRIAKLITELTE

Enzyme Prediction     

No EC number prediction in MGYG000000164_01970.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.10e-48	20	405	18	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	3.16e-20	81	413	55	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	4.42e-20	3	408	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	4.48e-14	184	404	147	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03795	GT4_WfcD-like	2.16e-13	159	395	115	349	Escherichia coli alpha-1,3-mannosyltransferase WfcD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP-linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97563.1	2.19e-213	1	412	1	404
QDW73676.1	2.22e-204	1	411	1	402
QEI32678.1	5.01e-203	1	411	1	403
QRT31239.1	5.01e-203	1	411	1	403
QHB22013.1	5.01e-203	1	411	1	403

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000164_01970.