CAZyme Information: MGYG000000164_02217

Basic Information

• Species: Mediterraneibacter_A butyricigenes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter_A; Mediterraneibacter_A butyricigenes
• CAZyme ID: MGYG000000164_02217
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000000164_6|CGC4	48184.26	6.7786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000164	3102552	Isolate	China	Asia

• Gene Location: Start: 252918; End: 254159 Strand: +

Full Sequence      

MNKVKLFFQKLIPFIKRRGLRGVWEKILIKLHLRKEQFPLIDAYHFIVEEQKVPFVEKDF
EAHKEDETILLNWVIPEMGKGSGGHINIFRFISNLENMGFHSRLYLHLASNFRDNKSLKE
FLRENFAILDERVEVFWDVKYAEFAHATIATSWQTAYFVKNFDNTISKFYFVQDYEPYFY
PLGSEAEFAKATYTFGFRGITAGDWLKDKLAQEFGMKTDSFGFSYDKELYKPYKKKSAAK
RVFFYARPVTPRRDFEMGILALDLLCQKMPEVEVVFAGWDVSEFKIPFKHQSLGIVSIDQ
LSKVYSQCDLCFVLSNTNLSLLPLEVMASNSVAVCSTGANSTWLVNKENSVLVDYDPHHI
AETLEYYLKHEEELETIRRKGLEFARSTSWEAEAEKVKDAILKGIAEDKNERH

Enzyme Prediction     

No EC number prediction in MGYG000000164_02217.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.12e-13	200	401	145	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	3.23e-09	234	397	186	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03800	GT4_sucrose_synthase	6.18e-09	225	396	196	395	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
cd03825	GT4_WcaC-like	9.30e-09	200	385	142	344	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03794	GT4_WbuB-like	2.24e-04	223	398	200	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX25932.1	2.24e-190	1	411	1	407
AMK55186.1	7.17e-172	4	408	1	400
CCI71311.1	3.91e-103	18	403	23	406
ABM68323.1	5.76e-98	12	409	24	414
BBP72133.1	9.00e-98	2	402	8	402

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	2.37e-25	149	402	995	1254	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000164_02217.