CAZyme Information: MGYG000000166_00163

Basic Information

• Species: Limosilactobacillus fermentum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus fermentum
• CAZyme ID: MGYG000000166_00163
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000000166_1|CGC2	21307.26	9.0363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000166	1967639	Isolate	China	Asia

• Gene Location: Start: 164831; End: 165445 Strand: +

Full Sequence      

MLKKNLLKISATLGAAALGVAATASVANADTVYTVQSGDTLSGISQKFANNNSLVDSLAK
NNNIQNINLIYVGQQLLIKDNGEITQATQAQAQTLPSANTTSTAGSQASTNTQAQATTPA
TSTAATTTTSSSDDAAKSWIAARESGGSYTAQNGNYYGKYQLSRAYLGGDYSAANQERVA
DQYVASRYGSWSAAKSFWLANGWY

Enzyme Prediction     

No EC number prediction in MGYG000000166_00163.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.02e-05	31	78	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	4.53e-04	33	78	2	44	Lysin motif.
pfam01476	LysM	0.002	33	79	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd13925	RPF	0.007	139	193	5	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY00454.1	1.05e-113	1	204	1	204
QIX58034.1	1.05e-113	1	204	1	204
QZY76909.1	1.05e-113	1	204	1	204
QCJ28234.1	1.05e-113	1	204	1	204
QSH38339.1	1.05e-113	1	204	1	204

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998595	0.000202	0.000274	0.000233	0.000202

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000166_00163.