CAZyme Information: MGYG000000168_01210

Basic Information

• Species: Butyricimonas sp003479425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp003479425
• CAZyme ID: MGYG000000168_01210
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000000168_2|CGC2	75389.57	5.1364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000168	5206610	Isolate	China	Asia

• Gene Location: Start: 339128; End: 341104 Strand: -

Full Sequence      

MRFVFVVMFFLCGCAGTSPLSLQKDYCNILDITNWPQGIREGISLFSDLGAWHGFAFIPD
SARMTGGFSGPLSMASNYAVGPYTANALVEVDGVLQKTADAKIEKSYFPGRMVQSFAWEE
LTLTQEIVFVNNRASLLRTWVRNMGGPKEVKVTYEGRFFTQCFQGRTIGQGKVLLEFPAT
KCCFEIAAGESCKAEVKDGLYRFDYGIRKMKRGEEREDVFVYSAYFNDEPDSVKYPVLEG
DPFTDSEPFFEGSASRWDHYLTKLLENKSSLLEDLRYKRLAVKCLMTLMANWRSAAHDLL
HDGGYPSYWGFSTGFWSWDSWKIAAGVCRWEPELAKSHIRALFDYQTEEGMIPDFVSRIK
YINNLRDTKPPLASWAVNEIYEADGDLAFVGEMFDRLLKYHRWWYTYRDIDGDGLCEYGS
TDGTLEAAAWESGMDNAVRFDSVGMLKGRVPRAWSMDQESVDLNAYLYDEKVTLARFARL
LKREDVASRLEKEADELARKIRTIMFDRETGYFFDVKMEGHDVVRVYGPEGWLPLWAKVA
DREQAGKVKDIMMDGNRFNSYVPLGTLDLSHSKLEPQRGYWRGPVWLDQVYFGIRGLRNY
GYDNEANELTLKVLNNCQGLLGDQPIQENYNPLTGDRLNAPHFGWSAAHLLLMMFEYK

Enzyme Prediction     

No EC number prediction in MGYG000000168_01210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	239	656	1.2e-97	0.49473684210526314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.98e-142	7	653	12	779	alpha-glucosidase; Provisional
pfam01204	Trehalase	3.98e-19	318	618	131	460	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	9.82e-19	304	656	275	605	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	7.86e-12	318	552	156	431	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	1.94e-08	451	653	240	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD44200.1	1.79e-187	16	656	23	671
QUT85676.1	9.04e-184	12	656	19	688
QJR78111.1	9.04e-184	12	656	19	688
AII65461.1	1.28e-183	12	656	19	688
ABR38022.1	1.28e-183	12	656	19	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.44e-87	25	657	4	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.86e-86	25	657	4	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.99e-86	25	657	4	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	6.02e-82	25	657	5	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.55e-43	427	657	42	305	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	4.72e-86	25	657	27	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	6.11e-22	278	656	67	487	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.45e-21	278	656	67	487	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
Q9W2M2	3.81e-10	315	631	197	544	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
K5BDL0	2.33e-07	316	651	40	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000168_01210.