CAZyme Information: MGYG000000168_03879

Basic Information

• Species: Butyricimonas sp003479425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp003479425
• CAZyme ID: MGYG000000168_03879
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42431.21	8.5245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000168	5206610	Isolate	China	Asia

• Gene Location: Start: 4964; End: 6091 Strand: +

Full Sequence      

MRYYVIAGEASGDLHASNLIKGLRRLDADAEVRGWGGDLMREAGCDIVRHYKDTAIMGFL
TVLKNLDKIKTNIEECHRDILEWKPDVVILVDYGGFNLRVAEFIKEAGIRVFYYISPKIW
AWNTGRVKKIKRLVDRMFVIFPFEVDFYARYDYPVQYAGNPLVDAIHDRPFKEETFDEFV
KANGLSGKPIVALVAGSRSQELKHVLPKMLTMVKHFPDHEFVIAGAPSMSDADYAPYLRD
MNVKIVYGQTYRLVKQARAALVTSGTATLETAILRTPQVVCYSGEGGAFSYFLFKTFVKV
KYISLVNLIAGREVVTELLMQKLNEKNVLRELSAILPEGEKRNQMLAGYDDVNDKLGDAG
ASVRFARMMIDDLKA

Enzyme Prediction     

No EC number prediction in MGYG000000168_03879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	6.9e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.30e-112	1	374	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.57e-104	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.52e-77	4	357	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.43e-63	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.20e-50	1	331	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51639.1	1.17e-251	1	373	1	373
AZS31618.1	6.46e-249	1	373	1	373
ADY31424.1	4.05e-199	1	374	1	374
SNV26174.1	4.05e-199	1	374	1	374
BAX81022.1	2.28e-150	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.03e-44	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.83e-44	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	4.22e-77	2	370	8	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	2.43e-76	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	8.46e-74	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.58e-70	2	371	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	2.23e-70	5	370	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000168_03879.