CAZyme Information: MGYG000000169_01959

Basic Information

• Species: Eubacterium_G sp000432355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp000432355
• CAZyme ID: MGYG000000169_01959
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898	MGYG000000169_8|CGC2	99434.46	4.6403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000169	2836880	Isolate	China	Asia

• Gene Location: Start: 73345; End: 76041 Strand: +

Full Sequence      

MTRKAKRMLAKFMALVMAVTVLSFTGGFSSMQSSVVYGAAAWNSETIYTGGDEVEYNGAI
YKCKWWTKGDTPSNGGPWELVSGSTSGGDTGDLGSLKPGKATVTLDPQIGTNVNGVTLPS
NYYNKKVVGYFPSYAITSQAHEYFNIADLQWDKLTHIQYAFGIVNKDTCELEVGDPEHDI
ESKFEGTTFKHDGQVIKMDDSLGYYGQFNIMHTLKKMHPDVTVLISTGGWGASEGLWYAT
QNEASMRKFSASAVSFIRKYGFDGIDIDFEFPSETPQSGNYTDFTESIRSGIADRYAQFI
KILSEDLAKASKEDGTYYWLTSAVAASSWVLGGQTNSAFLDYLDFVSVMSYDFHGGWNNY
VENQANLYADPADTETAQVDVKTLGFDWAYRFYRGKVQSEKILMGVPYYTRGWTNVSGGT
NGLHGSSGTPLTNSVDNLNLWCDLDENGKEVAAGANPLWHVMNLMKSNSNYKRYWDDVGK
VPHIWNAQNNTFLTFEDTESVQERINYVNNNNLGGVLIWVMHGDYDYDEQQQKYVIGDTL
TSMFHDQFKAKGASKVSSDVDYTNDTLNFSVDFGGKYDHPNYTYTIKLTNNESVAFPAGY
TLSFDLPKSSKFTSAWGATATTEDKGDFTTVTLTSTSALSPGESVEFTGMLKCCFSGVKN
FKVNGYSMLSEVNNEITRLNRAYLTDKNGGSSEIPTEPETEAPTEKPTEVPTQTPTEKPT
EAPTQVPTTKPDTKVQTSVKGYQISTTAEGYRVLYNVSDSDNEVVKAGLIYGLSDKATEN
EMVVGSGNQAVYDYAATNAGLLSKSGDTSLYAMTMEFVKTKAFYQAGIMVRPYAQLKSGE
YVYGDVESLKVYDIADSLYQKELMPNEAAHSYLYNNILKVSDSSYIEKTFNYKNILVK

Enzyme Prediction     

No EC number prediction in MGYG000000169_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	124	534	1.7e-64	0.972972972972973
CBM5	40	78	2.6e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	1.09e-86	126	524	1	334	Glyco_18 domain.
cd06548	GH18_chitinase	1.85e-86	127	524	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	2.19e-85	97	526	4	425	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	2.78e-66	126	524	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	3.57e-49	127	519	1	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRI54327.1	3.02e-186	117	665	44	604
AUM94626.1	4.26e-186	117	665	44	604
AUM98212.1	4.26e-186	117	665	44	604
AVQ39185.1	4.26e-186	117	665	44	604
CBZ02608.1	4.26e-186	117	665	44	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TXG_A	1.93e-114	41	663	54	771	CrystalStructure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]
1ITX_A	7.73e-49	126	524	13	406	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	3.08e-48	124	524	36	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KST_A	2.33e-46	126	524	8	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	8.01e-46	147	524	26	357	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96156	7.50e-77	125	609	320	884	Chitodextrinase OS=Vibrio furnissii OX=29494 GN=endo I PE=1 SV=1
P20533	4.53e-46	126	524	45	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P11797	6.31e-34	209	524	76	408	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
P32470	2.09e-33	144	519	54	378	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9QRF2	1.74e-30	128	524	46	389	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022701	0.809107	0.166610	0.000911	0.000352	0.000289

TMHMM  Annotations     

start	end
12	31