CAZyme Information: MGYG000000170_01152

Basic Information

• Species: Alistipes_A sp900240235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900240235
• CAZyme ID: MGYG000000170_01152
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		90157.58	5.9432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000170	3119069	Isolate	China	Asia

• Gene Location: Start: 97810; End: 100206 Strand: +

Full Sequence      

MKKFYLPICFVLCTLAAPVAAQIHLEGYRQADIAPQWLDGRWTAQWISVPGEPQNAYGIY
HFRKTFELPEQPERFVVHVSADNRYKLYVNGELASVGPARGDVFNWNFETVDLARWLKPG
KNTLAAVVWNFAEMKPVAQVSFNQTGLIVQGNTAAEEAVNTNDSWLCSHNGSYKPHQARV
YGYYAAGPGEQVDAAAYPWGWETPGFDDSAWNKAQAGMTGGAKGARDYPGRLLVPTPIPP
MENRTERFAEVRRSDGVRIPEGFPGRAATVTVPAHTTAEILLDNDSLTTAYLSLLFSGGK
GSQITVAYAEALYRDTQTFFKDDRNEVKNKQFLGYEDIVRPDGGNGRLYTTLWWRTWRYV
KLTVTTQDDPLELQDIYGTFTAYPFERASSFAAPGHEKLSRMLDIGWRTARLCANETYMD
CPYYEQLQYFGDTRIQAMISLYNTRDPYMVRNALEQGRQSIVADGITMSRYPSGLHQFIS
SFSLYWICTGYDYWRYRGDEEYLKTLLPAFRGVLSWYEGFLREDHSLGYIPHWFFADWAS
NFDGGEPIREKEGNSAFQDLLFVMGLDAMAEMEQAFGIPMYGERFRKMADAIRGTIRPKY
WDENKGLFADTYDRRNYSQHVNVLAVLLGAVSGNEAKAVMERTLSDTTLTQATIYFRYYL
NQALQKAGLGDRLLDNLKVWDDQMALGLTTWAEQPEPSRSDCHAWGASPNIEFFRIVLGI
DSDGPGFSKVRIAPSLGKLKEASGSIPHPQGDVAVRYHVGKRGELFAEISLPDAVEGTFV
WKGETRPLRGGTQTINIK

Enzyme Prediction     

No EC number prediction in MGYG000000170_01152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	278	778	3.3e-111	0.9801587301587301
CBM67	44	216	7.2e-50	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.18e-19	386	717	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.77e-07	71	241	2	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam06202	GDE_C	1.05e-04	483	613	86	223	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17390	Bac_rhamnosid_C	2.44e-04	719	795	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	0.004	484	641	129	297	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24404.1	0.0	1	798	1	798
QUT47620.1	0.0	1	798	4	807
QKH98192.1	0.0	1	797	1	804
QUT94468.1	0.0	1	797	1	804
QUT22158.1	0.0	1	797	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	3.94e-42	42	776	6	936	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	4.55e-31	57	755	56	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3W5M_A	1.03e-06	34	222	104	289	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.60e-06	34	222	104	289	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999115	0.000169	0.000151	0.000149	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000170_01152.