CAZyme Information: MGYG000000170_01222

Basic Information

• Species: Alistipes_A sp900240235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900240235
• CAZyme ID: MGYG000000170_01222
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000000170_3|CGC1	83704.83	6.3612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000170	3119069	Isolate	China	Asia

• Gene Location: Start: 180861; End: 183146 Strand: +

Full Sequence      

MKKILLPVPALCVGVLLCLSLRGEAPSRLTTDLAEHTDRVWIGGYPSQVTLEQADKIVEP
ARFVTIGSRRPSFGWQVNDSRSDVMQTACRILLASSPGTLATDSADLWDSGVIPGDRSVA
VPYAGKALEPGKIYYWKVMTFNNGNPQPWSAVKAFRTADSLTEYATPAYPLEKTDNGLPK
TTQKLSDRLVFADFGYDAFGQLRLTLCSHAGGDTVTVRLGECLKDGRIDPAPGGSRRFLS
QRLALLPGIRTYTVKIPADARNTGPQAVRMPDYIGEVYPFRYCEIEGDAIGNGTGIISRQ
VVNYPFDDLAAEFASSDTTLNQVWELCKYSIKATSFAGLYVDGDRERIPYEADALINQLS
HYCVDREYTMARRSHEYLLGNATWPTEWILQSVLIAWYDYLYTGDLRAVKTHYETLKNKT
LTALSGTDGFVSLTPEKLTPELYASINLRGQTLKNIVDWPHTGILGLGKAEGGETDGFVF
RDVNTVVNAYHYCALELMARMAGAAGESEDSAAYARAAGRLADNFNKQLFNKKTGAYRDG
IGTDHCSLHANMFPLCFGLADVKRAQSVADFVKTRGMACSVYGSQFLMDGLYEAGEADYA
LQLLTSDAERSWYNMIRVGSTISLEAWDDKYKPNQDWNHAWGAAPANIIPRRLMGVVPTE
PGFSRIEIRPQPAGLEKASLRIPTIRGDVETAFENTPDRFTLTTVVPANVKADVYLPLPA
GTKNYDVTVNGKPAGQTVREGNFIKIADQGSGKNAYILNTK

Enzyme Prediction     

No EC number prediction in MGYG000000170_01222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	185	716	5.2e-104	0.9920634920634921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.62e-54	310	653	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.52e-14	655	723	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24339.1	0.0	1	761	1	761
BCI64227.1	0.0	1	758	1	748
SCM57069.1	3.55e-283	25	756	27	755
SCD21001.1	9.41e-281	2	753	4	752
QUT49405.1	9.06e-277	17	759	19	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	7.04e-14	313	717	539	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	4.76e-13	380	717	557	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3CIH_A	7.18e-13	149	695	162	678	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3W5M_A	8.26e-08	66	157	20	110	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.30e-169	33	716	458	1136	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	5.56e-09	140	716	335	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	4.51e-07	66	157	20	110	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006749	0.528978	0.463090	0.000378	0.000374	0.000413

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000170_01222.