CAZyme Information: MGYG000000170_01223

Basic Information

• Species: Alistipes_A sp900240235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900240235
• CAZyme ID: MGYG000000170_01223
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000170_3|CGC1	65665.29	6.6363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000170	3119069	Isolate	China	Asia

• Gene Location: Start: 183176; End: 184945 Strand: +

Full Sequence      

MKKLFICAFLVYAASLQAQPMGKGNLPPVFPKEVAEKTQFDTRTRAYISPVRVMWTQNGD
LITGSENLLLQGNGQATTANTPKTVFVSKEGKRPSILLDFGREIHGGLQFVTCIRASTKP
VKVRVRLGESVGEAMCEITKENGATNDHAMRDYTIELPWLGVCEVGNSGFRFVRIDMLED
DVELPIKEIRASLLYRDIPYLGSFRSNDPRVDSIWATGAYTLHLNLQEYLVEAPKRDRLV
WLGDLHPEVRTALAVFGDNEALSRGLDFARDETPLPGWMNGMCSYSLWWVLIHRDYYMYR
GDLNYLKQQQQYLSDLMKILMSKVDAEGREHLDGGGRFLDWPTSEDTLAVNAGLHALMLM
TFEAGAEMLNALGDKELAAQCTATADRMKKVTPDYKTSKQSAALIALAGIVPAETANKEV
LEVGGAHGFSTFYGYYMLKAQALAGDYTDAIQNMKDYWGGMLDLGATTFWEDFDINWKKN
AARIDELIPAGKVDVHRTYGDYCYKGYRHSLAHGWASGPTAWLSEYVLGVKIVEPGCKAV
KIEPNLGGLEWVEGTVPTPYGVIKVRHEKQADGKIKSKIEVPKGVKVVK

Enzyme Prediction     

No EC number prediction in MGYG000000170_01223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	94	587	4.3e-102	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.52e-22	202	474	4	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.52e-08	529	586	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24783.1	0.0	21	589	1	569
BCI64228.1	0.0	1	589	9	596
BCG54529.1	1.60e-304	1	589	1	583
QUT48045.1	1.76e-263	1	589	1	583
QEC52590.1	9.23e-255	2	589	3	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.45e-49	71	565	169	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.84e-15	95	528	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000286	0.999017	0.000183	0.000170	0.000163	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000170_01223.