CAZyme Information: MGYG000000170_01840

Basic Information

• Species: Alistipes_A sp900240235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900240235
• CAZyme ID: MGYG000000170_01840
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		31829.53	5.6596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000170	3119069	Isolate	China	Asia

• Gene Location: Start: 226143; End: 226961 Strand: +

Full Sequence      

MSNCKILYVCQEITPYLPESDMSVLCRTLSQNMQERGNEIRTFMPRYGLINERRNQLHEV
IRLSGMNLIIDNNDHQLIIKVASIPAARVQIYFIDNEDYFHRKAIVRDENGVLFPDNDER
AIFFARGVLETVKKLRWTPDVVHCHGWFSSIVPVYLRNLFADDPIFKKVKIVVSLYDDAF
EGELDKKFKAKIQGEGVPKKYLDYLDDPTYENLMKFVINYADGVIFETPEPAAPIVDFLH
EKKKPFLEFQDKTTAEYLDHYQAFYNKILANE

Enzyme Prediction     

No EC number prediction in MGYG000000170_01840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	225	1.3e-44	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	9.33e-55	6	225	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	1.18e-46	2	237	4	237	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.90e-38	5	224	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.81e-25	5	224	2	201	glycogen synthase GlgA.
COG0297	GlgA	5.88e-25	5	225	2	213	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23346.1	4.05e-204	1	272	1	272
BBL11572.1	1.82e-135	5	268	4	267
BBL08780.1	1.82e-135	5	268	4	267
AFL77981.1	1.82e-135	5	268	4	267
BBL00775.1	7.38e-135	5	268	4	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	4.03e-07	5	192	2	179	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNF_A	4.30e-06	5	205	23	227	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4S584	1.37e-43	2	237	4	237	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
B3EGV0	9.97e-42	3	197	5	200	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	9.97e-42	3	197	5	200	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3QR00	1.37e-41	3	235	5	235	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1
A1BIY8	1.39e-41	3	197	5	200	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000013	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000170_01840.