CAZyme Information: MGYG000000170_02002

Basic Information

• Species: Alistipes_A sp900240235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A sp900240235
• CAZyme ID: MGYG000000170_02002
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	MGYG000000170_6|CGC2	70555.52	6.9078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000170	3119069	Isolate	China	Asia

• Gene Location: Start: 105995; End: 107890 Strand: +

Full Sequence      

MKRKVISAALLSLLIVGETAAARKPSATFKRAPEPTVQTHVDGYLGGRIDACIRVRVMSE
DENLLVAPFRQRNETNRWQSEFWGKWTLGAIGAYRYNRDPQLLQKIGNGVSGLLSTQSED
GYIGNYAPEAQLTNWDVWGQKYTLLGLLAYYDLTGDKKAIEGACKLADRLMTVIPAKKEI
EMAGIYRGLPPSSILEPIVYLYNRTGNGKYLDFAKYIVGRWETDKGPQLIGKALAGVPVA
ERFPFKSGWETWCSWDNGQKAYEMMSCYDGLLELYKITKNPDYLKAVEATVRNIIDEEIN
IAGSGSAFECFYHGKRLQTDPAYHTMETCVTMTWMKLCQNLLDLTKNPLYADQIEKTTYN
ALLAALKEDAGQIAKYSPLEGVRSAGEHQCGMHVNCCNSNGPRAFAMIPTAAVLSSNDSL
FVNLYGPSTTKASLGKNEISLEQTTAYPEDGDIEIAVNAPRNLEFAVAVRIPAWSKVSRV
AVNGESIGDVRPGTYVTVRRRWEPGDKISVNLDMRGRLVELNGYQAIERGPIVLARDSRF
DDGFVDEASVIQANADGYVELMPVTEADKPEKMWMVYTAPLVLGTDLEGDFYKPRQIRFC
DFASAGNTWDRRIRYRVWLKKTYNVILAPQQ

Enzyme Prediction     

No EC number prediction in MGYG000000170_02002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	80	535	2.1e-60	0.8866799204771372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.65e-70	84	535	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.93e-56	24	535	4	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG4225	YesR	0.003	135	314	34	182	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	0.006	145	292	93	232	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.83e-202	41	629	29	616
AXC10260.1	1.69e-42	40	537	98	600
QHS51661.1	4.17e-41	85	537	123	582
AZO44522.1	1.11e-40	24	550	11	577
AID31548.1	4.20e-40	20	620	10	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.54e-35	146	541	151	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	8.90e-28	79	618	90	682	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.09e-20	85	607	80	646	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.12e-20	85	607	80	646	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	2.60e-20	85	607	80	646	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.99e-20	85	607	80	646	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000717	0.998158	0.000507	0.000224	0.000196	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000170_02002.