CAZyme Information: MGYG000000172_04739

Basic Information

• Species: Enterocloster lavalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster lavalensis
• CAZyme ID: MGYG000000172_04739
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000000172_20|CGC1	57378.35	5.4902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000172	6502338	Isolate	China	Asia

• Gene Location: Start: 84303; End: 85862 Strand: +

Full Sequence      

MEFNVIYTKGRCAVLETADGGIYTTKETYQLFLNGEPAGPVQKVITPIYRLSPSTDYLAE
LRLGDGVVAQARFTTEPESVTLNVRDFGAAGDGIKDDTLAIQSAIMACPPQGRVLIPAGR
YSFVCLFLKDGINLELEKGAELSAVTDRERFPFYPGMVPYTDQTGDYCLGTWEGDPQKMF
CGLITGVHVKNVNIYGEGTLNGNASHENWWHNCKEMKIAWRPRAVFLNGCENISLVGLTV
KNSPSWTIHPYFSNHLRFLGLNVLAPKDSHNTDGLDPESCRHVELAGIHFSVGDDCIAVK
SGKIYMGKTYRTPSEHITIRQCSMNDGHGSVVIGSEIGAGVRDLIVRDCIFKDTDRGLRI
KTRRGRGEDCVVDRVAFENIRMDGVLTPFVVNCFYFCDPDGRTEYVQSKEPLPVDERTPS
IRELSFKDIHAENAHYAAVCAYGLPEQKIGHLKFENISVSYAPQVQPEIPAMMDGLEPMA
KAGIVARNVRLLTLKNVDIKGCAGDPVQAENVEIIENVE

Enzyme Prediction     

No EC number prediction in MGYG000000172_04739.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	109	465	7.2e-72	0.916923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.10e-98	13	511	13	542	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02793	PLN02793	1.32e-31	82	449	53	387	Probable polygalacturonase
pfam00295	Glyco_hydro_28	1.70e-30	184	463	48	307	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	1.02e-27	79	449	34	367	polygalacturonase/glycoside hydrolase family protein
PLN02218	PLN02218	1.57e-25	66	449	53	401	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR03573.1	4.60e-228	1	512	1	515
ANU47529.1	4.60e-228	1	512	1	515
QIX91771.1	7.55e-227	1	512	1	515
QRP36832.1	3.85e-222	1	512	1	515
ASN98356.1	3.85e-222	1	512	1	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	5.98e-38	82	367	28	335	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	3.95e-33	61	367	18	344	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	1.99e-29	98	432	26	336	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	9.18e-26	51	411	120	516	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MR0_A	3.49e-07	65	243	99	264	Crystalstructure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6],4MR0_B Crystal structure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	4.63e-59	223	479	23	281	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.64e-40	86	478	67	449	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P18192	1.19e-28	98	432	52	362	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P26509	1.62e-28	98	432	52	362	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1
Q9LW07	2.77e-27	79	395	21	301	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000172_04739.