CAZyme Information: MGYG000000172_04740

Basic Information

• Species: Enterocloster lavalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster lavalensis
• CAZyme ID: MGYG000000172_04740
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000000172_20|CGC1	43115.1	4.876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000172	6502338	Isolate	China	Asia

• Gene Location: Start: 85924; End: 87048 Strand: -

Full Sequence      

MEILDRYISQLLENSTPECPAWFKEKREEGCGLKWNYIDGCMIKAVLELYHMNQDTSYLE
FADGFIDRFVNEDGSIVSYRPEDYNLDNVNAGKTLFDLYHLTGKAKYRKGIDLIYSQLQT
QPRTKGGNFWHKQIYPNQIWLDGLYMALPFYMQYEVEYNGGKNCGDILRQFCNVREYMRD
PRNGLYYHAYDDSRSAFWCDPVTGLSDSFWLRALGWFAMALVDTAELMTGEPRKRLSAMY
RELIDAMLPYQDQASGMWYQVVNRGGIEPNYLETSGSAIFAYAIMKSARIGLLPPSYFAF
GEKAFDGICSRYLSVENGELQLDGICLVAGLGNVERREGTFDYYMREPIVKNEAKGVAPL
VLAYIELLKKHEPV

Enzyme Prediction     

No EC number prediction in MGYG000000172_04740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	33	369	3.6e-105	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.01e-88	35	369	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.57e-79	34	369	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91776.1	2.68e-201	1	373	1	376
ANU47524.1	5.40e-201	1	373	1	376
QQR03578.1	5.40e-201	1	373	1	376
QRP36827.1	2.55e-199	1	368	1	371
ASN98361.1	2.55e-199	1	368	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.39e-98	35	366	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.16e-60	34	367	38	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.15e-60	34	367	28	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	1.01e-08	35	371	66	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	3.18e-08	35	371	65	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.18e-59	34	367	38	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.97e-45	146	368	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.97e-45	146	368	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.71e-18	26	290	20	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000172_04740.