CAZyme Information: MGYG000000172_05008

Basic Information

• Species: Enterocloster lavalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster lavalensis
• CAZyme ID: MGYG000000172_05008
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1298	MGYG000000172_23|CGC3	146516.57	5.4443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000172	6502338	Isolate	China	Asia

• Gene Location: Start: 66454; End: 70350 Strand: +

Full Sequence      

MKDVSYEILDLFETYGSDPEGISRALAAEKRPEYLYALSDIRQNLLEWYPFDGTEQVLEI
GSGYGALTGLLAKRAAHVTVLDESDENLEVNRRRNGGCANISYGLEDPSRKFDLVVICGV
KKGTSAPAAVERGCSFLAEEGSLILACENSLGLRYLAGGSHGEDQADFTRSQVAGAFADR
GFKEVEFYYPTPDYRLAVSIYSDRYLPGKGELADGPAYDEPRYSCVNQEAVFDLLEQEGD
FGRFSNSFLVAASKKAWESRTIFVKYNRTRREAFAIRTSIGEENGRRYVEKTALDDAGSW
HILSFEKKYAQLQALCPNIHILKPEMGGDGRSVRFEFLAGVTLAEKLGRQISDGRAPVAA
IREAMDLVFAVPEDQTGPFKVTPEFTEVFGAVPELSDRAYRASNIDGLFENLMEVDGRIY
CLDYEWVFDFPVPAGFVQYRNLAYFYYKYQRQMVYASLEEFLGEFGVSRELAGVYGAMEQ
AFQAYVHGDGNQGYLANYQQKVTTLEELKAADGELSRARERINQLQAEVEEKNQQIRKEQ
EVQRLTNNHVANLEVMIKDLRHEIDELGKFATYLNGHEALVFKARRKLGAQVNKAFPKGT
RKRKVLNYCFNTVKHPCRYGKLYLTSEGRRQIDGDFKIGEDYLKYGRLKFKTYDEASGEM
PLVSIVIPCYNQVHYTYACLQSILEHTGDVSYEVIIADDVSTDATAELDKFVEGLVIRRN
STNQGFLRNCNQAALAARGKYIMFLNNDTKVTPGWLSSLVNLIESDPSIGMVGSKLVYPD
GRLQEAGGIIWSDGSGWNYGRLDDPEKAEYNYVKDVDYISGAAILLSVSLWKQIGGFDER
FAPAYCEDSDLAFEVRRAGYRVVYQPLSRVIHFEGVSNGTDVNGTGLKRYQVENSRKLKE
KWAGEFKKQCVNDGNPNPFRARERSQGKPVVLVVDHYVPTFDRDAGSKTTYQYLKMFLKK
GYVVKFLGDNFLHEEPYSTALQQMGIEVLYGDEYAAGIWDWIKKNGDEIDFAYLNRPHIA
TKYVDFIKDYTKIKVIYYGHDLHFLRLGREYELTGDINIKREADYWKSVELTMMYKAAVS
YYPSNVEVEAIHAIDAGIRAKAITAYVYDTFLTDIQDDFAKREGLLFVGGFAHPPNADAV
LWFAREVFPKIRAELPEVKFYVVGSKVTEEIKALAQPDNGIVIKGFVSEEELARLYATCK
VVVVPLRYGAGVKGKVVEAIYNGAPIVTTATGAEGIPFVDQVLKIADGAENFASATVSLY
RDNTRCRQLCHRTQDYIRKHFSLDGAWEVVKGDFSRWQ

Enzyme Prediction     

No EC number prediction in MGYG000000172_05008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	664	912	4.6e-24	0.8779661016949153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.95e-47	665	874	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.05e-46	660	879	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	6.52e-27	642	870	35	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13692	Glyco_trans_1_4	8.01e-24	1125	1262	4	138	Glycosyl transferases group 1.
pfam00535	Glycos_transf_2	1.25e-23	664	784	1	124	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21849.1	0.0	1	1294	1	1313
ASN93838.1	0.0	1	1294	1	1313
QRP41495.1	0.0	1	1294	1	1313
QIX92521.1	0.0	1	1294	1	1314
ANU46567.1	0.0	1	1294	1	1314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z87_A	9.11e-07	647	877	360	578	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	9.12e-07	647	877	361	579	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.12e-23	661	925	625	893	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.15e-18	661	881	574	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WLV8	4.29e-12	661	802	17	148	Uncharacterized protein MT1568 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1568 PE=4 SV=1
P9WLV9	4.29e-12	661	802	17	148	Uncharacterized protein Rv1518 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1518 PE=4 SV=1
Q8MYY6	4.10e-10	663	907	112	381	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000172_05008.