CAZyme Information: MGYG000000172_05499

Basic Information

• Species: Enterocloster lavalensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster lavalensis
• CAZyme ID: MGYG000000172_05499
• CAZy Family: GT2
• CAZyme Description: N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		30417	6.8333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000172	6502338	Isolate	China	Asia

• Gene Location: Start: 19221; End: 20009 Strand: +

Full Sequence      

MSVKLSACIVAYNNYEDIKDAIASMEQFTSPELTKKIYIVDNGVAISSPSDVEELRRYIE
KWGDIEYIDAGQNLGFGKGHNTVLGKIDSDYHAIVNPDILFCEDAFSKVIAWMDEHNDVG
MVIPDIIDEYGKRQLVYREELTVFDMFVRFFCKGLFPGRIRKHTLQDKDYSKPFQVPFGQ
GSFLVVKTNLFKELNGFDDNFFMYVEDADLCKRVNQVSKLMYFPGARIIHKWEKGSHGNK
ILFKYHVQSMKYYFKKWGVKII

Enzyme Prediction     

No EC number prediction in MGYG000000172_05499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	192	1e-15	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.21e-38	9	231	3	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.60e-34	1	257	1	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.98e-13	6	155	1	147	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02526	GT2_RfbF_like	1.25e-10	7	216	1	188	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
COG0463	WcaA	4.11e-06	1	254	1	241	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APP03582.1	4.45e-129	1	262	1	259
ATP37118.1	6.99e-122	1	262	1	262
AUJ30855.1	1.25e-90	3	262	6	259
QOG30491.1	9.50e-88	5	261	6	258
ATO53386.1	2.70e-85	5	260	7	261

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36667	5.62e-15	9	249	6	239	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
P9WMY2	8.49e-12	1	230	1	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	8.49e-12	1	230	1	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000172_05499.