CAZyme Information: MGYG000000173_00544

Basic Information

• Species: Bulleidia moorei
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia; Bulleidia moorei
• CAZyme ID: MGYG000000173_00544
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000000173_1|CGC7	85801.38	6.511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000173	1989881	Isolate	China	Asia

• Gene Location: Start: 566935; End: 569193 Strand: -

Full Sequence      

MTLEKQLESSLKKQIKNATDRELYDAIVAIVKEKQDQVKKITGEKKLYYISAEFLIGKQL
GKNLINLGLYDELAKLLSKNGKSIRTVESFEKEPSLGNGGLGRLAACFLDSIATLNLQGD
GVGLNYHLGLFRQEFKDRKQHEIPDEWLNGSTVLRDTNVSFPVELAGKTYYSHMYDLDII
GYKTNKNTLHLFDLDTVDESIVHDGTKFDKKNIDKNLTLFLYPDDSDKDGQLLRIYQQYF
MVSNAAQLIIKEEQEKGHNLNDLDKYVSIQINDTHPSMVIPELIRLLINEGITFRRAADI
VANTCAYTNHTILAEALEKWPLDYLQEVVPQLVPIIGGLDYAANIAFKGDQELTIIDDNH
RVHMARMDMHFSSSINGVAALHTEILKHQELKPFYNIYHSKFNNKTNGITFRRWIMHCNP
ELANYIDTLIGDAWRKDASKLEDLLKYINDTAVLQKLDDIKYTNKVRLADMIKKEEGIEI
NPSSIFDIQVKRLHEYKRQQMNALWAIYKYLQIKAGQKPARPITVIFGAKAAPAYIMAKN
IIHLIICLQDLIKNDPEVSPYLKVVMLQNYNVTKAETVIPACDISEQISLASKEASGTGN
MKFMLNGAITLGTNDGANVEIGELVGKDNIYTFGCSSDEVIKLYETSGYHAADYYNNSRL
IHACVDFITSPELVKLGNKQMLSDLRDNLINKDWFMTLLDLEEYCRVKDRVLADYEDRLA
WKKKSLVNIAKSGFFSSDRTILDYNRDIWHLK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	77	752	1.4e-223	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	45	752	70	811	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	3	752	13	749	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	19	752	30	797	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	5	751	3	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	3	751	4	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG86654.1	0.0	1	752	1	752
QRO38542.1	0.0	7	752	10	754
QBF75418.1	0.0	7	752	10	754
QYX28643.1	0.0	7	752	10	754
QRT50443.1	0.0	7	751	9	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	1.52e-310	5	750	10	756	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	3.72e-174	18	752	28	789	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
7TM7_A	5.16e-170	35	752	58	803	ChainA, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286],7TM7_B Chain B, Alpha-1,4 glucan phosphorylase [Klebsiella pneumoniae subsp. pneumoniae HS11286]
5OX0_A	1.41e-167	7	752	36	829	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	1.62e-167	7	752	24	817	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	0.0	1	752	2	752	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P39123	4.47e-188	5	752	14	795	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
Q9XTL9	8.65e-176	45	752	81	829	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
Q5MIB6	3.15e-169	45	749	81	826	Glycogen phosphorylase, brain form OS=Ovis aries OX=9940 GN=PYGB PE=2 SV=3
P73511	1.48e-168	49	752	86	827	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000173_00544.