CAZyme Information: MGYG000000173_01006

Basic Information

• Species: Bulleidia moorei
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia; Bulleidia moorei
• CAZyme ID: MGYG000000173_01006
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		96571.18	5.2837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000173	1989881	Isolate	China	Asia

• Gene Location: Start: 320264; End: 322858 Strand: +

Full Sequence      

MTQKKKSFLPDFDHPEKVEQPDEKQREKLRKKYIRKLRWQKILTVFMVLVVGIYVVGGIY
AVRYASKLLKGMPTLNVDDLISTESSKIYDGNGTLLTEIGTYYRENIPYEQMPESLIDAF
LSVEDSRFFEHNGFDIPRFTKSVLETVLRHNTQGGSTFTMQLVKNTYFSIEDGDNSTERS
ATLSYKAQQIVLSMQLEKQLSKREIFELYVNKLNFGDRIRGVQKAAQYYYGKNASQLTLA
ESALLAGIINLPNTYNPYNYLDYATQRRNNVLDLMQYHGYITSEECALAKSIKVEDTLVG
KSNFNTGNTRFASYLDVVLDEVQRMTGLDPLSTGMSIYTALDPTIQTEIEAIQNGEVVDF
ESDLVQLAMITLNNKNGEIVGVGGGRNYGGDGGSRLLNRALQQYKQPGSSIKPVLEYALA
FEYLGYSLDEVLVDKPITYPAEQRVLVNYNGKYEGDVTIKDAMANSLNTPAIQTLQKVTA
KIGSDAVVDYLKKIGFSQVKYSNYHLSYAIGGNDFTASVAEMAAAHAMLVNLGVYNEPHT
IRRILTDDGNVYEPQNQNIRALSSGSAYLVDQLMENNVNQNKYYNHMQILQSGYPVYAKT
GTTDWGNDGLQYGIPSGAAKDKWMVASTSQYTNAVWYGFDQAIDGEMTYFPTWRDWNTPG
QINRHMLDIESYISPDTIGGVSQPSDVQDVTYLYGTYPHVTNDDSNYGGKTITSQVSSSG
LNYTPTQYTSSYRNNNSYLAGLNASISNGIVYINWLTQDTCSGSRNISLKDNYNNISKSG
ACLAYNSFLQSSANGKFYADLYQDDVYITSVTSKTNMYAGIPEYFKGKIKACGYFVTSSG
KKSETICTDAGYYDPDATAAKDTK

Enzyme Prediction     

No EC number prediction in MGYG000000173_01006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	93	276	8.3e-57	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.51e-139	28	655	2	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	7.56e-93	34	641	2	693	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.09e-71	99	641	136	659	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	9.16e-71	92	276	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	3.80e-70	85	641	36	538	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG86014.1	0.0	53	862	24	826
APO28576.1	1.11e-220	35	699	23	695
QRG87111.1	1.20e-201	35	700	14	679
QSI26123.1	5.58e-149	39	668	22	662
ANU69519.1	2.73e-143	39	744	22	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.67e-82	86	641	8	559	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	4.32e-79	86	709	17	636	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	2.04e-55	195	641	2	434	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	8.02e-51	195	641	2	434	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
5U2G_A	1.27e-43	69	549	7	560	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04707	2.92e-93	37	643	7	603	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q00573	4.09e-93	37	643	7	604	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q8DR59	1.09e-92	37	643	7	603	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P39793	2.15e-90	44	813	40	786	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
P38050	9.21e-68	62	641	25	572	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999965	0.000068	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	64