CAZyme Information: MGYG000000174_00008

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_00008
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		70153.22	6.8946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 11517; End: 13379 Strand: +

Full Sequence      

MKTKLVIPSFLLCLATMPVLAQNPAQSPVTHIKISGYVGERIDDCIKHRVKAQDVDHLVE
PFRHREEKTRWQSEFWGKWIQGAIASYRYNQDPELYQIIKNAAESLMSTQTADGYIGNYA
PNAQLQQWDIWGRKYTTLGLIAWYDLSGDKKALDAACRVVDHLMTQVGPGKVNIVSTGNY
IGMPSSSILEPVMYLYNRTKEARYLDYAKYIVEQWETPDGPQLISKAIAGIPVANRFPHP
KTWFSRENGQKAYEMMSCYEGLLELYKVTGNPLYLSVVEKTVEHIVQEEINIAGSGSAFE
CWYSGKARQTIPTYHTMETCVTFTWMQLCNRLLQMTGNSLYADYMESAIYNALMASLKAD
ASQIAKYSPLEGCRHEGEEQCGMHINCCNANGPRAFAMIPQFAYQVKDDCIRVNFYGESE
AEVTLPGKKNVRIRQITDYPVTDEITLQVDPAKDSPFTIALRIPAWSRQTMVLVNGEPED
GVLQGAYLPVTRKWKAGDKITVRLDLRARLVEMNQAQAIVRGPLVLARDSRFNDGFIDET
TVVVNKDGYVELTPVKAPDFAWMAFTAPLILGTDLEGNSAARPIHFCDFASAGNTWDRSQ
RYRVWLPRTLNVMHAPYKPY

Enzyme Prediction     

No EC number prediction in MGYG000000174_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	67	526	5.3e-67	0.9064885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	2.26e-71	28	542	13	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	3.72e-70	77	527	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	6.76e-241	25	620	20	620
ACM22580.1	3.76e-49	28	577	21	584
AXC10260.1	1.14e-47	78	528	133	592
QOY86860.1	1.29e-47	78	525	97	547
AJG40529.1	5.75e-47	28	577	19	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.12e-31	26	525	10	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.95e-29	26	525	10	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.60e-27	72	530	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
7EXU_A	5.03e-23	78	582	80	611	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	6.50e-23	78	582	80	611	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.56e-22	78	582	80	611	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999074	0.000191	0.000158	0.000157	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_00008.