CAZyme Information: MGYG000000174_00016

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_00016
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000000174_1|CGC1	83308.46	6.3661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 21065; End: 23272 Strand: +

Full Sequence      

MRKYLLLCACVGFLVSAEAKNKTDWKAHWINTEQCQSASNTWLAYRKTVSLAEVPRTLTA
HIAADSKYWLWINGRMVVFEGGLKRGPSPYDTYYDSVEIAPYLTSGENTIAVLVWHFGKN
GFSHVNSGLAALLFEAIAPGIEIVSDKSWNCRVYDAYQDTEAPYPNYRLSESNIRFDARR
AMEGWNQPGYKNSFPGAEIASIVGKAPLGELVERPIPLFKDYGLKDYPGVRQSANGDTLF
CRLPYNCQFTPYLKVEAADGATIQMQTDNYRGGGPENVRAEYITRNGVQEYESYGWMSGH
EMWYILPEGVKVLEVKYRETGYDTEFAGSFQCNDPFLNELWKRSARTLYITMRDNYMDCP
ERERAQWWGDEVNELGEAFYALSPSSHKLALKGIYELMNWQRPDGSLFAPVPAGNWSKEL
PLQMLASVGWYGFYTQYYYSGDSTFVPVIYDRLHRYLHETWKVDKSGLPIERSGEWSWGD
WGEQIDMGVLTNCWYYLALKAEKEFALQLGKKEDAEDISRMMSSIEQCFNTKFWTGTAYR
SPGYRGEDDDRSQAMAVLSGLAPKEKYPALLKVLKKEYHASPYMEKYVLEALFRMNAPDV
AMQRMRDRYAGMLGYKGYTTLFEGWGVGAEGFGGGTINHAWSGGPLTLLSQKVCGIEPTS
PGFRTFRVKPQMGSLTEASATVPTLYGDIKVKLRKSGRNILMEIEVPEQTSAEVVSPKGK
IQQIGSGTYNLKCPF

Enzyme Prediction     

No EC number prediction in MGYG000000174_00016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	259	715	1.4e-89	0.9107142857142857
CBM67	27	193	2e-33	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.61e-26	325	653	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.70e-14	655	717	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.72e-09	55	217	3	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	1	732	1	730
ABR43077.1	0.0	25	731	31	737
QRO16732.1	0.0	25	731	31	737
QKH97686.1	0.0	4	731	11	738
QCY56550.1	0.0	25	727	31	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.42e-15	24	235	5	212	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.65e-16	45	724	187	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.93e-15	21	717	145	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KM26	4.94e-15	325	713	728	1133	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999016	0.000248	0.000164	0.000143	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_00016.