CAZyme Information: MGYG000000174_00734

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_00734
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1158	MGYG000000174_1|CGC14	132647.39	5.722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 846491; End: 849967 Strand: -

Full Sequence      

MRKKLFYFVVALIIYPYICIGQTIASMDSRPTDVEHWISSHFAQGTVPPFSFEYGGKPSK
EFIKDWAYSAKPLKSDDQHEVRYCYTYQDPVGGLKVDCDVKGFTDSQAVEWVLRFTNTGS
GNTPEIANVCVSDIVFCYDRPGNFRLHYANGSFPSKADFAPRLKELTSGENLYMRPDGGR
SSHTAFPFFNIESPSGQGVMVAIGWTGTWFSNVRCTDAQSIQLKSGIERLKAYLYPKETI
RTSSVCLLFWQGNNRMIGHNQFRRFILAHHTRKVDGKPAQYPFCKGFNYGDPPPCNEYTC
LTADYAIALVKRYKQFKLLPEVFWLDAGWYDQSADVANNKNWANTVGNWTVDSVRFPEGL
KPIADEIHKVGSKFMVWFEPERVYYGSAWAIEHPEYMLERPGADACLVNLGNPKACRWMS
EYIGDFIEENNIDYYRQDFNIEPAGFWEANDEPGRQGICEIKYIEGLYAFWDYLLERFPN
LLIDNCASGGRRLDLETTTRSAPLWRTDYSYGEPDGYQCHTYGLNFYLPLHGTGAWGVDK
YTCRSSLSSAVTFNWKITEAGVSIYDMRDRQAEFEELRPYFLEDYYPLSGIDNTTAENTW
LAYQLYRKSDDSGYIVAFRRKECPDKDCRVELSGVNPDKTYLLINKDTGDSIRKTGKELS
EGLTLTLNEPRSSMIIRYQSDLSEPVHDLVVGEKTDAVLQAIGAEFDPHFLSQNVTRNDG
AKEKDWKNIIEKRIKDMDIHRLRVMVLPQWYEPENDNDDPGLINWDKFTFNSPEMQSLYR
ELDLAQQQQMEVTLTLWGAPDKHFLAGRNSGNWVVAPESNEEWSENFSALIQYLIKEKKY
TCIKEITPVNEPDWSFLVNGKRASTAKYIEMCKALDRRFKKDGIRELVDFSLSDNSDGGI
GTHKYLAACTRELADVADVFNSHTYIFGYETPNSTILDWERQNYELSKSAGKPHFVGEFG
GNQCVGAARQKDINLYERGVLMVRIAINLLNAGASGVSYWSLIDQYYGKNDSYEGMQQLG
LWKYVKNAYAQDTCYENMTVDYEVRPQYFAYSLLTRFIRPGAEVYPISTPDEFYAGTAIK
NKDGKWVYIFANGTAQEKKIKISNKHVGAKGTYEVYKYAQNALPKGDKQISPEKRAMKGG
NEFFYTLPTNSVILLREK

Enzyme Prediction     

No EC number prediction in MGYG000000174_00734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	82	647	1.5e-73	0.8168604651162791
GH30	735	1152	1.2e-20	0.8345323741007195

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.54e-40	295	495	10	206	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	7.59e-29	321	495	73	247	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	4.74e-23	179	523	185	529	Alpha-galactosidase [Carbohydrate transport and metabolism].
COG1501	YicI	5.34e-07	308	480	284	455	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd14792	GH27	8.04e-06	323	374	40	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM10797.1	0.0	1	1158	1	1169
QRM99265.1	0.0	1	1158	1	1169
QUT78888.1	0.0	1	1158	1	1169
CBK67650.1	0.0	1	1158	1	1169
QUT32037.1	0.0	1	1158	1	1169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	6.27e-28	179	508	226	552	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	1.45e-27	179	508	226	552	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	1.87e-23	86	508	137	549	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
6JHP_A	1.29e-19	89	512	169	585	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
2YFN_A	6.32e-19	298	642	340	683	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	3.43e-27	179	508	226	552	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.09e-23	309	656	353	710	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P16551	1.96e-21	158	535	166	530	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
P43469	2.20e-19	179	508	220	542	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
Q5AU92	2.33e-19	89	512	161	577	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019908	0.957017	0.022240	0.000294	0.000254	0.000261

TMHMM  Annotations     

start	end
5	27