CAZyme Information: MGYG000000174_01175

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_01175
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000000174_2|CGC9	55436.57	5.3597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 548822; End: 550291 Strand: +

Full Sequence      

MKTHRYLFLSFSFLALIISGCIGNKETSKQPEISIQLLWNDIKQPIDGFGVAQAGWADEL
YSHKNREKIMDEMFGPDGLRLNILRGEIFPHYWENKNDKDFNLTDDLEIDLDDPFFEGKS
DDRLRRGQLWLTLLAKNKYHVDKLFFSAWSAPAYMKTNGKVSQGELKPECYQEYADYLAS
FYKAYTSVGLEPYALSPSNEPGYAAPWNSSLWTPERMGEFITRYLGPTFKRMQIPARIIF
GENPLWSAVSPQADFASSLYFTNTILEKYPEIKDFNLIAAGHGYTLPDSYPAPKDSLLTP
IVPLELAEKNNIPVWVTEISDINPLDTTINDGLKWASTYHAFLTEANANAFIWWAGAMPT
NNNESLIVLNSDRVGYSLTKRYETFGNYTRYIATGSLRIGTQISNPTDSLLVSAYKNEKN
YTIVAVNNSSRSIRTGIKPTETGDSGTLISYLTDENNRWSPQNYSIDKKGQYIVNIPAKC
IMTFTGSTK

Enzyme Prediction     

No EC number prediction in MGYG000000174_01175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	35	483	2.2e-171	0.9933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	5.99e-30	43	484	44	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam14587	Glyco_hydr_30_2	4.20e-15	41	367	10	366	O-Glycosyl hydrolase family 30.
pfam02055	Glyco_hydro_30	8.69e-11	46	230	1	191	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT78450.1	6.70e-203	1	489	1	491
QRP59665.1	6.70e-203	1	489	1	491
ASM65029.1	6.70e-203	1	489	1	491
QUU06757.1	4.15e-162	1	352	1	355
QQY39420.1	7.32e-134	35	487	44	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7O0E_A	5.26e-25	44	483	14	444	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	2.84e-24	11	484	3	469	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
7NCX_AAA	4.05e-24	44	483	21	451	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6KRL_A	4.35e-24	22	484	82	540	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
6M5Z_A	9.36e-22	44	488	34	455	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	1.77e-25	14	483	6	468	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q45070	5.02e-16	2	484	7	418	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	1.62e-14	2	484	7	419	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
G5ECR8	2.98e-13	44	234	102	297	Putative glucosylceramidase 3 OS=Caenorhabditis elegans OX=6239 GN=gba-3 PE=3 SV=1
Q9UB00	8.40e-11	44	403	97	458	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_01175.