CAZyme Information: MGYG000000174_01940

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_01940
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68005.72	6.9361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 221621; End: 223420 Strand: -

Full Sequence      

MNKISIYVLTLCLSFCSVSLYSQNNKARIITTNELNDNIFYHTIERGQTVYSIATMYGVT
VDDIYRLNPESRESIKAGATLKIPQRDAGTAPMGKAEDNFLYHTIQPKETLYSLSIRYAV
PGTDIIEANPGLSTSTFTIGKTIRIPATPIETLPTKEVKSVTKEIEYTIAKKETMYRICR
KFNISSTELIKRNPELKNGVKAGMVIKIPVETKETVTETAPVMHERDVNALLSTPKKIER
VNMIKVALLLPFMTNEAKPSSNTQRFIEYYEGLLLAVDSLRNSGCSIELSVFDTGNGTKK
VKEILKEDVLKEANLIIGAVQNDQIAPVAEFAEKNNIKYVIPFTSKNDDVLSNANIFQVN
TPHSYLYAKASQAGCDLFANDNIILLKVPGTEEKTDFVKALQGEMKQRNISWRELTYSSE
TFPVEMEAMLSTDKRSVIIPTSGSLEALNKFKAPLRMLAETKPEYNITMFGYPEWQTYTN
ECLDDFFALNTYIYSFFYADNLSPEVSDFYSKYKTWYSKTLINIFPKYGILGFDTGMFFF
DAIRKYGSNFENNLGNIRYKGIQTCFDFERVNNWGGFINTSTFIVHYQSDYNVTRSEVR

Enzyme Prediction     

No EC number prediction in MGYG000000174_01940.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	7.05e-10	41	83	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.52e-07	42	84	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	5.42e-07	41	83	1	44	Lysin motif.
cd06347	PBP1_ABC_LivK_ligand_binding-like	7.18e-07	271	548	21	295	type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.
smart00257	LysM	1.45e-06	102	145	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48586.1	0.0	1	599	1	600
QUR46882.1	3.20e-316	1	599	1	602
QJE27971.1	3.20e-316	1	599	1	602
QCY56025.1	3.20e-316	1	599	1	602
ABR42587.1	3.20e-316	1	599	1	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	5.49e-06	39	147	1	94	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001281	0.527152	0.470661	0.000330	0.000290	0.000258

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_01940.