CAZyme Information: MGYG000000174_02082

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_02082
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926	MGYG000000174_4|CGC9	104658.02	5.1835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 406481; End: 409261 Strand: +

Full Sequence      

MRLLTNTFLLAAFLFLPVKVFSQTQQNELEQIRQNYTRSLIDSNNDSDLLNRILAGIPPE
TEMSDQVVVELHQRYPFNLDKIKEYMDNINEDGSWPDIDYNDTKRSGWDAKKHADRILEL
AKLYHAEGSSCTWSPRFSTVIHQALDYWFRTKPVCKNWWYNEIGIPKTFGPAFLLLRTQM
RPDELKEAVKVMDNARFGMTGQNKVWLAGNVLMKGLLLDDYDLVKAARDTIMSEITTGRE
EGIKSDWSFHQHGPQQQFGNYGLAYLGEMSFYSELFAGTSFALNAEQQAILNNLLTEGYR
WIIWRGYMDVNALDRQLFHNAPIHKALAIGNAANSLKKGSAPADVEKLDAFLNDNFPPQS
SDGAVFTGQKHFWDSDQTVHRAPAWMASVKMASQRVIGTELVNEDNLKGFYMGDGATYIY
RHGDEYLNVFPFWDWRKIPGITSYESDAPVPSPRSYGAHTRNESSFVGGVTDGHTGMTAM
VLNRDGVHARKAWIMTDDYVLCLGAGIKTDSTLSLTTSIDQRKKRGELFYLENNRWNTVN
GTFTATGKALRFYHDSTGYILMQPSNSVSISEKRSGSWSDFMGSYTPQTVEGEVVSLYIR
HPKESPASYQYLILPAVSADRTASFCTDDIRVLSNDENMQAVGIDNCFYITAYQAGNIRL
ADDMLLEIQTPGIYMLSVENGAIRVEASDPTHMQTSLSLKINDYALKIMQLVDQVSGQSI
SITPVISAPLVKHISVDGKKDDWAQIPVAVSGLIAPWDGAVKDQTTFSVCHDRKNLYFIY
EVSDSTIIYNNEKTEASVGSSDRIEFFFSKDTTMTDYYCAEIDPHGKVMDYHAKFYRKFN
FDWNFKGLKLGTYVGKNTYIVEGSIPLKTLEDMGVISPEGEMCFGVYRADYYGPEEEQVI
WSSWIIPDAADPDFHIPSSLGVLKLR

Enzyme Prediction     

No EC number prediction in MGYG000000174_02082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	370	618	4.2e-67	0.9845559845559846
CBM9	736	925	3.2e-19	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	6.26e-141	61	690	3	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.99e-87	370	618	2	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.18e-26	90	309	41	276	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
cd09620	CBM9_like_3	1.17e-15	736	917	1	197	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
pfam06452	CBM9_1	2.59e-05	736	870	1	132	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47778.1	0.0	15	900	14	897
QDO71119.1	1.72e-268	1	722	1	721
QUT90440.1	1.03e-264	1	722	1	721
ALJ58447.1	2.36e-263	1	722	1	721
QCT78112.1	6.67e-250	22	683	19	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.10e-80	78	703	23	652	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.76e-80	78	703	45	674	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RW9_A	7.09e-37	157	701	124	714	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	7.09e-37	157	701	124	714	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
2WCO_A	1.25e-35	116	656	93	682	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	9.64e-80	78	703	45	674	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	2.58e-30	95	740	68	766	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	1.62e-24	157	676	182	753	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q53591	5.57e-18	157	642	370	925	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q54873	3.64e-14	152	642	402	944	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999160	0.000161	0.000155	0.000151	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_02082.