CAZyme Information: MGYG000000174_02086

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_02086
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1139		128182.67	5.8523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 140; End: 3559 Strand: -

Full Sequence      

MNNLEKSRHRKPVLSTLILWLSVLTVSAQTTTLHPVASNDCGVDGKQPFLVKGDNYTMPD
EIGGSVTARTCNFGGTVIYAFDRMDIQADYQLEVVYLSDSERRQRIVADGNEVQSPVVLE
KGKEQRYRIDLPKKAFAYGQLVLVFEVLKGPNALVSELNLYSSNPKKPVPFEGDQKLALS
HTQSYQVDTTVNAEEHLPVYTAIPYSVPGVYDPVLSLNGTWQFNPSPEAGFQNREAEAGG
WYPIIVPGQWSMQGFKVDSAGFGGYLTTFTLPADWKGKQVKLRFDGVSSECTVWLNGKEI
GTHMGGMTAFELDATPALQPGVNRLALKVRSESLADMLGSLTQYAAHQLGGITRKVTLFA
VPDVHISDIRIVTDLDEKYKDADLKVYLAVTNSGKETEKNIAARLSIAGLPVVLDRQIPS
LAPGETWNGWLTGTVRDPQKWDNEHPYLYTMKIELENGDHTAEQIEKRFGFREVQIEGNR
LLVNGKPVKLRGVCRHEAHPLTGRVMTPELERKDVELYRAANCNFIRTSHYPPCEELLQV
CDELGMFVEVEAPVCWIGHHANENWKTLDYQDSKYYPYVLQANMETIHFYRNHPSVIFWS
IANESYWNKEFAQVEVYVKKADPTRPHTFHDQAYGGFNNQGSTAPITNIHYPGPDGYKVA
AKSERPMVYGEYCHLNVYNRSELVTDPGVRSDWALALSPTWDNMYKTDGVLGGSIWSGID
DIFQMPNGDAVGYGPWGPIDGWRRPKPEYWDMKKIYSPVRVHTAQLSPAKELTVALENRY
TYTDFSELQIHWKYGEEQGISFASIRPGENGQIRIPIENPDKANELYLSFTDPRGFVADE
YIIPVGKQVQNELLELQPVATQLKKTNDVYRITGKNFSCEVSRTTGQILSLKQGKQEVLN
GGPWLMALPLNGGGCYPNHNANTPLFNDICTEWKPAEIDAIKDGDDVIVSVKGSYKEFEG
SYKLIINAGGKLSVSYSFDALADVNPRQWGLVFEAPATFDKTFWRRDGLWSVYPDDHISR
PVGEAELFYSGLPSHLNPRVEPSWSWSLDYNELGSNDFRSTRRNIWYAGLTDHAGNKVTA
VSDGKQHWRSWLEKDRIRFLVADFVTAGNEMFLGSYYAPFRKPLKKGDTIGGTVMLYVE

Enzyme Prediction     

No EC number prediction in MGYG000000174_02086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	212	1017	4.5e-138	0.9561170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	1.08e-86	215	905	42	761	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	3.12e-78	203	891	1	684	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	2.75e-61	216	626	54	484	beta-galactosidase.
PRK10150	PRK10150	2.19e-60	214	629	12	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	9.75e-40	474	759	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50207.1	0.0	24	1139	22	1137
QRO24898.1	0.0	24	1139	17	1124
AQT68269.1	9.70e-312	6	1134	3	1209
BBE16084.1	6.92e-294	201	1136	40	983
AOM75904.1	3.03e-262	27	1139	21	1122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	8.67e-64	215	899	39	742	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	8.72e-64	215	899	40	743	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	8.81e-63	216	1044	46	911	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	4.18e-57	198	831	29	696	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6ZJV_A	8.52e-52	213	837	56	683	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A [Arthrobacter sp. 32cB],6ZJW_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with galactose [Arthrobacter sp. 32cB],6ZJX_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with saccharose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	4.78e-63	215	899	40	743	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.88e-54	216	1042	60	935	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q9K9C6	1.85e-49	216	1045	47	917	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
P06864	2.62e-49	215	903	42	759	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
A4W7D2	1.64e-46	216	829	55	702	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998949	0.000249	0.000171	0.000162	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_02086.