CAZyme Information: MGYG000000174_02515

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_02515
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000000174_6|CGC6	77469.03	6.085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 185548; End: 187575 Strand: -

Full Sequence      

MNNKFLLSLILTIGLCSTVSLAKADNPDHPNNRYPLIRKPYMELPLGSIKAKGWLLEMLE
RQKKGASSQMDVLYPEVMGARNGWLGGDGDQWERGPYWIDGLLPLAYILDDKELKQKVQP
WIEWTLKSQREDGFFGPARDYSPEPGIQRDNSADWWPRMVMLKIMQQYYSATGDKRVIDF
MSNYFRYQLATLPSTPLGNWTFWAEYRACDNLQAVYWLYNITGEKFLLDLGNLLHKQSYD
FVDMFLNRNDLTRFNTIHCVNLAQGLKEPVIYYQQNPDKKYLDAVKKGLADIRQYNGQPQ
GMYGGDEGLHGNNPTQGSELCSAVEFMYSLEKMMEITGDLTLTDHLERIAFNALPTQITD
DFMDKQYFQQANQVMVTRHAHNFYEDANHAETDIIYGTRTGYPCCFSNMHQGWPKFTQSL
WYATPDNGIAALAYSPSEVTTKVGNGHRVTVTEDTHYPMDDKIQFTVRLLDKTKEVDFPL
HLRIPGWCKEATVTVNGVPESTAKGNSTAIIRRTWKTGDQVVLHLPMEVTTSKWYENSIA
VERGPLVYALKMEEKWEKKKFEGDDITQFGQSYYEVTSPTKWNYGILASAPENTKENFQI
TIDKAKLAGNYFWNVENAPIQIKVKAKEIPSWQLYNEMAGPLPFSTGRSKNPVEEITLIP
YGCTTLRVSEFPLVR

Enzyme Prediction     

No EC number prediction in MGYG000000174_02515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	549	1.9e-36	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.26e-62	97	549	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.42e-29	165	550	187	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMP98056.1	2.36e-169	8	674	6	651
ARS39276.1	8.18e-166	32	674	29	648
ALL07583.1	5.13e-165	8	674	6	651
QNK64903.1	3.82e-164	9	674	1	645
ATP55412.1	9.21e-163	8	674	6	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.99e-20	98	551	82	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.31e-19	88	551	100	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	2.40e-17	98	551	82	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.73e-15	99	586	76	578	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000711	0.979811	0.018702	0.000288	0.000235	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_02515.