CAZyme Information: MGYG000000174_03405

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_03405
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000174_10|CGC2	44266.49	5.9965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 139939; End: 141105 Strand: -

Full Sequence      

MYSLSLKHMAALAGLSAATLLPVNLIAETAVSPSIEQNTRSGFDKQEILSVAGKVADWQI
KEFPNNKYAISEPKGWIAGALYLGMYDWAELCGDTQYFDWLKKVFNRQHWQVADRMYHAD
DICVSQTYLDMYNKYKEEKMLLPTLARIDWVINNPSKGGLDIDYSKPVTYERWSWCDALF
MAPAVYTRLYTLTGNKKYMMFADTEFKATYNHLYDKDEKLFFRDSRYFGQKEANGKKVFW
GRGNGWVIGGLAEILKTLPVDDTEYRPFYLQLFQEISERLAGLQSKDGYWHASLLDPESY
PSPETSATGFIVYGLAYGVNHGYLPADKYLPVIEKGWKALVSAVEPDGKLGWVQPVGADP
RKVTRDMTELYGTGAFLMAACEIYNFNK

Enzyme Prediction     

No EC number prediction in MGYG000000174_03405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	74	384	1.4e-89	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.33e-104	51	386	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.25e-54	75	382	35	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	4.03e-220	5	384	56	436
QUT74307.1	4.37e-159	34	384	14	364
QDO67620.1	6.97e-157	20	384	7	368
ALJ59360.1	1.46e-155	35	384	16	366
QUT89583.1	1.46e-155	35	384	16	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	5.52e-75	43	383	24	366	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	8.51e-59	39	382	24	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.60e-51	126	386	105	357	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	3.16e-85	46	388	51	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	4.79e-78	34	388	20	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	6.62e-75	19	383	10	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	1.14e-11	43	353	6	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002892	0.996042	0.000345	0.000283	0.000205	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_03405.