CAZyme Information: MGYG000000174_03576

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_03576
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		63143.46	5.6606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 110476; End: 112113 Strand: -

Full Sequence      

MPQNASNLKPTFIIMMQGRLGNLMFDYALLLSMRSKYPEHEGFLYRDKDAPGKTGYFYEL
ENIFNIPASDFASEELMTHIKSLPLSLIQYVWEKDFACRPSISLDGFLVTICIGYWQTET
SFDNVKPEVRKAFSFNSNLLNGPTRQLAEKLKLQKAIALHVRRGDYLDSSHADMFINICT
VDYYREALIMIRNHAGNNLPLYCFSDDPDWVKSNLHLENCVVVDWNHGDDSWQDMYLMSL
CRHNIIANSTFSWWGAWLNGSRDKIVIAPYRCFNTMLTPEIHPDEWISIYPKGYVKNDFV
WSLEKNKISIEQDGLFYGKMGVVVFLFHYAFIRQDGFYENIAINLISEIFSQVNLQTSID
YANGLSGIGNAIEYLYQNDFISGDINEILCDFDLLFDDILAQEHNGVDWESNLLGLVRYY
RFRLSGKYIDPKNERTKKNKLNLFYLLNLLKNKRLASLLNNEDIISELYELSFLKLYPLQ
VNKLLGYYLFFSEYAGDALMQKAAKINQERYSAIKLGETPGLMGMAGKELMRLSPESKVS
WIKLL

Enzyme Prediction     

No EC number prediction in MGYG000000174_03576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	12	289	8.2e-65	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	9.91e-53	12	271	3	253	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.42e-21	2	289	23	297	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd04434	LanC_like	0.001	316	430	1	123	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04791	LanC_SerThrkinase	0.002	314	369	44	92	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd11548	NodZ_like	0.004	98	262	119	284	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63862.1	2.01e-63	13	289	4	284
QXP69641.1	3.61e-58	13	289	3	296
QXP67481.1	3.61e-58	13	289	3	296
AII69332.1	6.38e-58	13	289	3	278
ALA75149.1	6.38e-58	13	289	3	278

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	4.55e-32	16	289	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866E7	7.79e-15	2	289	72	353	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Aotus nancymaae OX=37293 GN=FUT1 PE=3 SV=1
Q866E6	7.79e-15	2	289	72	353	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Aotus azarae OX=30591 GN=FUT1 PE=3 SV=1
Q866E1	1.40e-14	2	289	72	353	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta belzebul OX=30590 GN=FUT1 PE=3 SV=1
Q866C9	1.87e-14	2	289	72	353	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_03576.