CAZyme Information: MGYG000000174_04023

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_04023
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000000174_15|CGC2	33308.02	6.9605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 106993; End: 107856 Strand: +

Full Sequence      

MKNKIILFLVLCFCINFAGIAQSTVHESVKFQSKKLGKEVSYSIYLPDGYATSNRYYPVL
YLLHGYTDNETMWIQTGQMQEITDRAINSDQAVPMIVVMPDAWDTWYINQYDGKAPYEDM
FFEELIPYIEKTYRARSNKEFRAIAGLSMGGYGSFLYSLHHPDMFSACAPLSAAIFDDSV
MEQRQAKSHKDLFNRLFGPGLDYWHKNSVLKMLSELDKENLPRIRYYIDCGDQDGLLDGN
FQAHQIMREKGMKHEFRVRGGGHTWLYWRTALPNILEFVSGAFRRNN

Enzyme Prediction     

No EC number prediction in MGYG000000174_04023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	279	2.5e-59	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	8.45e-39	17	285	16	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	2.70e-34	30	286	72	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	7.60e-32	33	276	1	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	3.20e-10	27	285	10	264	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG4099	COG4099	7.23e-10	28	172	162	301	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS34250.1	9.83e-36	16	279	96	342
AKD58571.1	7.66e-35	27	284	141	381
AMQ56447.1	1.60e-34	27	272	144	377
QBJ18653.1	5.43e-34	27	284	152	398
QUT61354.1	1.05e-33	27	284	152	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.30e-50	33	283	19	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	7.27e-25	29	284	135	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	3.16e-24	44	282	50	260	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	8.49e-24	44	282	50	260	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.20e-22	44	279	157	384	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	3.91e-25	44	285	449	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	3.39e-22	44	282	69	279	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	5.44e-20	27	277	501	722	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P23553	4.21e-19	60	280	44	262	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P9WM38	9.70e-17	30	265	178	427	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000460	0.998740	0.000266	0.000177	0.000173	0.000171

TMHMM  Annotations     

start	end
7	26