CAZyme Information: MGYG000000174_04729

Basic Information

• Species: Parabacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides faecis
• CAZyme ID: MGYG000000174_04729
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927	MGYG000000174_25|CGC2	104268.47	5.5074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000174	6515019	Isolate	China	Asia

• Gene Location: Start: 47985; End: 50768 Strand: +

Full Sequence      

MLKNFLSICFVLMMFTSCKEASSVISLAGEWQFAMDSTDVGVSEKWFDRSFADKIRLPGT
TDEAGYGIPNTLPPSISKPQIFHLTRKNSYVGPAWYSREVTIPSDWKEKSIELKLERVIW
QTRVWVDGKPVSGCCESLISPHIFDLTEYLTPGKHKLTVRVDNRKQHDISIDDKAHAYTN
ETQIMWNGIIGEISLTAKEALSIEDLQVYPDVSGRQVHVKGRINNRGEATKGSLQAVVQK
QKNTPITTVTRDMEFPSGESLLDITCPMGDSMQVWNEFTPTLYQLDLKVEAGSVRAGRST
KFGMREFRHNQSDLLLNGNKAFLRGTLECCVFPLTGRPPMEPEGWKKVFLTAREWGLNHL
RFHSWCPPEAAFQVADSLGFYLQVELPLWSLSVGQDQKTNEYLYAEADRILSEYGNHPSF
CFLSLGNELQPDFNFLSRLLSYVKAKDPRHLYTTTSFTFEGGHGDWPEPDDDFFITQWTK
KGWVRGQGVFDTQSPSFDKDYTASVEGMTVPLITHEVGQYSVYPNLKEIEKYTGVLDPLN
FKGVKQELEKKGLLDKADDYLKASGYLAALLYKEEIERAMKTAGCSGFQLLDLHDFPGQS
TALVGLLDAFWDSKGVTDAAIFRQASSPVSPLVRFPKAVYTNDEPFAATVEIANFTDKEL
KNQSVSWSLKDDKGKVVNEGTMTCPSLAIGLNKLPETITSPLNQPEAARLTLSVVLDNTP
YKNEWSIWVYPAQPDLDKGEIIVTRDLNEAVRALAGGKKVLYNPDYRQTVGLEGKFVPVF
WSPVHFPKQAGSMGILCDASHPAFSHFPTGNYTDWQWWSLLKQSKTIVTDNLPAVTPLVE
VIDNFANNRRLSNLFEVKVGPGKLLFCSMDLLSDWKQRPEARQLYFSLLEYMKSDSFSPS
NTMESDVLARLLIAEASSGASKPEDIY

Enzyme Prediction     

No EC number prediction in MGYG000000174_04729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	725	5.3e-73	0.7340425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.56e-23	22	460	10	440	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	1.90e-18	26	195	3	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10150	PRK10150	1.22e-13	23	164	11	137	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.44e-13	27	451	44	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	3.51e-06	203	305	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA00996.1	0.0	24	927	26	931
QOG04937.1	0.0	20	927	20	929
ASM65962.1	0.0	2	927	6	934
QRP59794.1	0.0	2	927	1	929
QQT79911.1	0.0	2	927	1	929

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.71e-22	25	451	40	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.71e-22	25	451	39	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
3GM8_A	1.69e-14	92	429	66	397	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5UJ6_A	1.79e-14	27	429	37	419	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	1.80e-14	27	429	45	427	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	9.35e-22	25	451	40	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	3.52e-15	94	486	105	492	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P24131	3.90e-13	26	451	48	481	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2
T2KM09	1.90e-11	92	454	106	456	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q04F24	7.42e-11	20	447	43	475	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.250094	0.749302	0.000108	0.000103	0.000097

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000174_04729.