CAZyme Information: MGYG000000175_01594

Basic Information

• Species: Muricomes sp000509105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes sp000509105
• CAZyme ID: MGYG000000175_01594
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
904	MGYG000000175_7|CGC2	103805.11	5.0585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000175	5055107	Isolate	China	Asia

• Gene Location: Start: 144157; End: 146871 Strand: -

Full Sequence      

MLKIKDLKCMHLVRPIGIDRNPYFSWILESNEKNVLQHSYQIEVRDNENRIVWDSTRQVS
EQSVYVDYRGEALKSRTRYIWKIRVEDNHGNQAEAFSEFETAFLKRDEWRAKWVKSPFST
VERKAHLGEQPSAVLFRQKVMLDKKVKEARLYATCHGVYRLTVNGKRPDDREFAPECTVY
RDYLCYQTYDVTEFLHTGTNIIGMHTGDGWYHGFMTKAQDESYDPAYAILTQLEVTYEDG
TTGCFVSDETIKVQESPVRCSDLFAGEVYDANKMPYGWESSGFNDSGWQSVIPADFGYGN
LKAQYGQPVRPIMKLPVKRMLTSPKGERIIDFGQVIAGRVRLYIQVPKDTKVTVIHTEGL
DAEGNFFDNNPTADQRIEYISDGTAQVYEPHFTFQGFRYVMIDGIEELKAEDITAIVLSS
EKQNVGTFSCSNDGVNRLYENTRWSQHANMLSLPTDCPQREKAGWTGDIQVYTKTALLNE
DITPFLTRWLENLACEQKKNGSVPFVVPLAGAYIGQYEMYEEQFRTPDAVSPAGWGDAAV
LIPYYMYCLTGNTHILKQQYDSMKNWCNFVLRTARENRPGDSTLPQEVEQYLWNTGHHYG
EHLIPSYSREGYGEGTLEAIRVSTRYVAPIYGYYSISIMSETAKVLGNDEDAQYYAKMSE
NMKTAIQKGVLDKKGNMPADLMGAYAMPIYYGLVPEDLMKKFAENLVRKIEENNGCLDVG
FLGMPILQDALCQIGRRDLAYDLLFNEKAPSWLYEVKHGATTIWESWFALDEDGTPFISE
IYGMTFCMSLNHYAFGCVDDWIFRNVNGINYVEPGFKKILIQPQLDERLDWAKRTFKSEY
GDIVSEWEKKGNIFELTVEIPCNTRAVIVLPDGQSYEKGSGEYHFRTDVSEVYQSTKEGR
RSVW

Enzyme Prediction     

No EC number prediction in MGYG000000175_01594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	322	870	1.4e-149	0.9940476190476191
CBM67	111	291	4.5e-32	0.9318181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.12e-103	425	806	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.26e-47	144	310	1	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.74e-23	322	419	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.29e-22	808	885	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO28640.1	3.53e-282	60	810	62	805
APO28678.1	9.31e-282	60	810	84	827
ARN19579.1	1.47e-256	1	885	1	856
ATU64247.1	2.67e-256	1	885	19	874
BBI36516.1	2.09e-225	2	878	14	902

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.63e-128	6	871	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.34e-123	2	886	2	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.48e-119	2	871	4	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	4.81e-132	15	875	47	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.68e-130	13	871	41	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.04e-118	2	871	4	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.41e-101	15	870	43	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000175_01594.