CAZyme Information: MGYG000000175_01742

Basic Information

• Species: Muricomes sp000509105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes sp000509105
• CAZyme ID: MGYG000000175_01742
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	MGYG000000175_8|CGC3	96132.2	4.9803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000175	5055107	Isolate	China	Asia

• Gene Location: Start: 101575; End: 104106 Strand: -

Full Sequence      

MKELALHTGWKLHEAPLRWGVSDIGRVMAFEDGWMDCALPCDVRMPLIESGVIKDPVLAD
YSRECEWISNRSWWFVREFDISELDIGDGPVELTLESLDTWAEIFLNGSHIGTHKSAHYP
FTFDIKCYLRPGKNVLCIRLTTGLEKVTEEQLAELEWSICHEKDAGHPERGDHRRTWLRR
PQYNAGWDFLPKAFSIGITGGAYVRCLSVAEIRSVDLETLEAGKDAHLRLRAEVEYFNPI
GCADADLDIMLRMDGVLCAYARVDDILLTAGINWIDLDVDVQDAKLWWPAGSGAQPLYDV
EVCLECCGSKTAYPKFQYGIRTIRLDISRQEDGRRGFGIVVNGVKIFCKGSNWVPNDPIY
ARVCDAKYEELIRAAHDANFNMLRIWGGGIYEREIFYRLCDRYGILIWHDFMLACGAFPD
HDPDFVREMENEADYQTRRLRNHPSMCLWCGDNELHRYFWYISLLKKNPDRQFGLRISNY
VSKKAVHANCSRIPYWNSSPFGGEFPDSEQVGDTHHWNCSMHPDMEKRIDPMAYDLINHA
FVSEYGYFGAPSRVAIESYFDGQPVDRLSGIWDHHNNDFEKGTVYGGIVKHYMDNPQSLD
LDGYILYSGMVQSLMYGYSLEALRFKPRCSGALFWMFNDSWGEVGWSVVDYCLQKKPSYY
GVKRAFSHRKLILRQVDGKLVVTGCNDTPDQVDTMAEVGYISLDGRVRDTRIVPLTLLPY
SRSHILETDFPEGDLERGVVAVIPESMEIAPERLFACETRCLDMPDGEPRVLCVEQDGGL
HLTITSDVFLHGVYIEGVNDCSDNYFELLPGQVKTVSIAARLRLMGSEFCRTLSVGEGLC
SNA

Enzyme Prediction     

No EC number prediction in MGYG000000175_01742.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	710	5.4e-80	0.6622340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.33e-54	19	678	19	652	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.88e-09	99	454	136	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	6.60e-08	775	835	10	73	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam02837	Glyco_hydro_2_N	4.98e-05	10	140	8	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	0.006	212	321	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77011.1	8.59e-285	1	818	1	824
QBE99829.1	8.59e-285	1	818	1	824
QIB55134.1	8.59e-285	1	818	1	824
QBE97186.1	5.40e-275	1	818	1	822
BBI35730.1	2.50e-246	3	828	2	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.52e-108	34	810	43	802	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.64e-101	4	828	9	826	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.75e-101	4	828	11	828	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.81e-101	4	828	11	828	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.27e-101	4	828	9	826	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	3.07e-76	19	664	13	651	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	2.50e-73	5	667	8	652	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	4.42e-72	32	664	24	651	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	2.96e-71	32	664	24	651	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1D911	2.00e-70	11	667	3	654	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000175_01742.