CAZyme Information: MGYG000000176_01394

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_01394
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000000176_4|CGC4	95061.64	4.8056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 299629; End: 302193 Strand: +

Full Sequence      

MRIQNIDREWKFYRGMADIYGSYSGNETETVVNLPHDYMIENDVLEDAPAGSASGFYNAG
IAYYKKTVNIPSDWVGEQVFLRFDGVMMNATVDINGCKAELHHYGYTPFCVDITPYIYYG
QDNNVLVLVNPSMQPNSRWYSGAGIFRSVEMIHVPPVHIVNDGIFGYTKKILYGNGGKAA
TAFLNTEVSVRNTTVADHMAEIEVSLVRDETDETVLTRRAKIQIDAGSVETAYIAMTVDA
PALWDIDTPFLYRLTAKVTDIGVFKTRFIESEEKISDCDSTLFGIRTVTADVRGGLQING
KTVKLRGGCVHHDNGLLGAVSLYDAEVRRIQKMKEVGFNAIRTTHNPPSKILMEVCDRLG
MYVFAEAFDTWGIGKLPGDYNQFFMADWEKDLEAFMVRDRNHPSIIIWSTGNEIPERGGL
NHGYTLATKIAKKAKTIDSSRLISNGICSYWSGLDDVLMAESLEKMVEHMKEGALSLQNA
DGGKADTSWEKMSEAFMNGLDVVGYNYMEDKYFIDHEMYPERIILGSENYPKEIGKRWPM
VERTPYVIGDFTWTAIDYIGEAGIGKSFFIEPDDPRLKKGLLVFDSSASQFPYRLANDAD
IDINGVILPQGHYRSVVFGSFDTHVFSYEPANFGKKELLSEWGFTACEKNWNWIGDEGKD
ISVIVFSRAEEVEIILNGRTVGRKKQGESLGTENIPLTFVFNLKYEPGELIAVSYMNGAE
VSRDSIATVGEPVSLKVSLDKNVMEADGHSLIYAEIEVTDAQDQLVPNAEIRLSASCDGA
AKLIGFGSGNPITIENYVSGKFTTYKGRCCAILRSGYEAGEALLTVNGDGLGSRSITVKV
NRTVMNDLDKIHVK

Enzyme Prediction     

No EC number prediction in MGYG000000176_01394.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	565	4.1e-102	0.5851063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.22e-58	58	446	80	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.92e-36	64	443	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	3.87e-36	10	413	19	417	beta-D-glucuronidase; Provisional
PRK09525	lacZ	2.73e-33	64	413	124	462	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	5.50e-29	735	837	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF23795.1	0.0	1	840	1	833
AHF24670.1	0.0	6	844	3	833
AHF25955.1	0.0	1	840	1	833
ADL35895.1	1.79e-315	1	840	1	819
AHF25051.1	1.14e-311	6	839	8	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.42e-138	1	838	5	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.05e-138	1	838	5	775	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	1.97e-105	5	838	11	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	7.30e-103	5	840	29	820	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	2.36e-102	1	838	1	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.21e-110	5	841	46	847	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.83e-76	5	836	50	815	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.69e-35	3	832	5	742	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	1.04e-31	5	839	30	794	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
Q9K9C6	5.90e-28	36	443	106	483	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_01394.