CAZyme Information: MGYG000000176_02914

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_02914
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000176_12|CGC1	40073.77	4.1408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 40040; End: 41092 Strand: -

Full Sequence      

MWKIAFDNQLVNQEQLVVGQALLILQPEESGSMRGDMYVTGYAYPFVEPYILEQAFPALN
ELLIFSYGFTFEGELVPPMQDELWMIEAAWEEGIEPLLVLTPFSNGAFNNQLVKVLVENL
EIQQRVIDNLLRTVEERGYSGVDIDFEYVLPENRIDYAEFVGRVREVMNANGYTVSVALA
PKTSADQPGLLYEGMDYALLGANADHVFLMTYEWGYTYGPPMAVAPLNKVREVVEYALTE
IPREKILMGIPNYAYDWTLPYERGITKARLIGNVEAVRIAAENGVSIQFSDIAQSPYFTY
MRDGFSHEVWFEDVRSIQAKLNLAREYELLGVGYWNLMRPFRANWLLLEK

Enzyme Prediction     

No EC number prediction in MGYG000000176_02914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	116	337	1.2e-39	0.6891891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.93e-119	39	348	4	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	8.25e-93	1	349	71	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.33e-32	81	337	46	290	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	2.07e-30	116	337	85	331	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.66e-28	116	337	82	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB23011.1	2.30e-192	1	349	22	370
QEI30503.1	2.30e-192	1	349	22	370
QRT29403.1	2.30e-192	1	349	22	370
APO31600.1	2.30e-192	1	349	22	370
QNM04685.1	7.89e-173	3	350	24	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	2.07e-74	72	349	148	424	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.63e-72	57	350	131	423	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	6.19e-62	45	337	19	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.23e-23	123	345	89	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	5.18e-20	43	335	3	322	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.17e-78	53	349	125	420	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	9.24e-71	57	350	130	422	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.02e-69	57	350	130	422	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	7.56e-63	8	350	76	413	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	2.70e-31	59	350	52	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_02914.