CAZyme Information: MGYG000000176_03313

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_03313
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	MGYG000000176_14|CGC4	95819.79	5.3385

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 118331; End: 120877 Strand: +

Full Sequence      

MKIRKMRTNHFVNPVGYDVSKLSLSWVAQSNGTRQEASHVEVSESSGFETLISDSGWKIL
DNLNYIPLDFAGKQLKLKPLTRYYWRVSVKADNGDGAVSETAYFETAKEGLPWKGKWICA
PFPEHPVFSGTFKAKTGQKARICICGVGLYEVYCNGKPVSNEALFPGYHSYDLQLLYQTF
EMDKLLCDGENEITVMLGKGWYMGRFGFGGGVVNTYGSHMAFLCDVYLDDSVVMCSDAFW
KCKKSPVTDSSIYDGEVWDARLEESVEWMNAELLEDTEAKKLSEALTERINPPVSVVEVR
KPVEIIRTPCGETVLDFGQNLAGWFTFTCDEEAGCKIEVDCAELMQDGEFYRENLRTAQA
KLTYISNGKRSRVRPHFTFFGFRYLRVRGLRDIAATSFQAHVLSSVCECTGEWETSNPLV
NRLIENSRWGQLGNFIEVPTDCPQRDERMGWTGDAQIFSATACYQYDSAAFYAKYIKDMW
LEQQVIGGSVPFIIPSPKADLMPGALQSSGSCAWSDAAAILPWTLYRFYGDRSLLEVEYQ
GMKAWVDFIRTQETEEHLWQSGFHFADWLALDNPNPGPAGKTDPFYCASAYYFYSASLVA
KAAKILGYGEDFSFYSSLAEDIRNAFQRTYFSEDGRCKIVTQTACALALMFELCRKNDRE
KIAEQLHKKLEKNQMHLDTGFVGTGYLCKALAASGYQKDAVTLLLQKDMPGWLYQVIMGA
TTIWERWNSVLPDGQVNPEGMNSLNHYANGAVCQWIYEDLCGISPIEPGFKKVLFAPKPD
SRLQYVKGKYESAMGTYRCGWEMTEGKYHYHLTVPFDCTAEVIINGKRIGNFPAGSYKFK
EETVSREL

Enzyme Prediction     

No EC number prediction in MGYG000000176_03313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	305	823	3.2e-165	0.996031746031746
CBM67	124	271	4.8e-17	0.7954545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.96e-127	410	758	3	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.36e-36	139	298	5	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.83e-25	306	404	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.24e-19	762	826	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIZ07546.1	8.85e-271	1	824	1	841
QHQ62976.1	5.70e-268	1	824	1	841
AVM69218.1	6.02e-267	1	830	1	888
QOV18450.1	6.02e-262	1	824	1	840
QKS45208.1	7.53e-259	1	822	1	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	9.83e-134	140	827	147	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.26e-124	13	822	42	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.10e-117	45	824	245	994	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	6.35e-121	11	823	40	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	3.22e-116	11	824	44	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.86e-116	45	824	245	994	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	9.73e-74	5	825	34	907	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_03313.