CAZyme Information: MGYG000000176_04333

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_04333
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
951	MGYG000000176_24|CGC1	108181.83	4.9709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 57014; End: 59869 Strand: +

Full Sequence      

MLIYDTKTEHLSNPLGLDSTNPRFSWKMSGNSRNAIQKTYQILAYSDDTQKNLVWDSGIV
ASDQSHSVCWEGPSLKSRQRIFWKVKLSVEYLEEQSNTTISDTLESNLVFFEMGLLDTTD
WIAHWILPEKTVDIDASKPAPYLRKEFYVKDTVVRARLYQSSHGLYEFWINGHIGTIDKF
KPGFTAYQKRVQYQTYDVTSLLSLGKNCWSVALGDGWWRGTIGGQSNNTFGYELSYIGQL
ELEYKDGSKEVIITDTDFVASTGGLLSSDMMFGDCYDATKEPLMWKECGFDSSNWHHATI
AQDDALIKQKLVPSRSVPVREMERFYPLILHTPDGSTVLDFGQNIAGYVSMKLHNCVAGQ
KVTLIHGEALDESGNFTQKNYAQTEIANSRTTQRIEYIMNGKSEEKYCPMFSIFGFRYVL
LKGYNEPIAPEDFQAIAVYSCMEETGTFTCSNRLINQLVHNSIWSQKGNFMDVPTDCPTR
ERNPYTGDAQVYVGTAINFMDVYSFFEKWMLDYIEEQYPTGKIPNTVPSISAVNHNDAEQ
HRRDQQILQMEDGPMKDTILSMNSTKDNGSFIDGSSGWADAATIIPYTLFLKYGDTQILK
NQYECCKKWVDYIAVEAAKENSLYKELPYYQIQDDAKYVWDTGFHWGEWLEADIDIYADM
WGFIGKLIKCPEYLSATMFYYYSSKIVSEMAHVLNEPDDEKKYGNIALRVKEVYNKYFIS
DDGVILEGRQALHVRALAFQLVNEEKKHSVANYLYQLVKSNNYTLNTGFLSTPYLLPVLA
ENGYIDAAYRLLEKIDSPSWLKPVSDGATTIPETWNGYETCSSSLNHYSYGAVCNFLFEY
VAGIRPIKQTPGYKHFLLQPIVGGSLTEAAAEYESVYGKIYSAWKKQGSSIAYEFTVPVN
TTATVKILGDEHDFTIIKQQFNDAVSNGKLICFTIGSGNYNIQTRGAEYGR

Enzyme Prediction     

No EC number prediction in MGYG000000176_04333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	330	906	1.7e-150	0.9940476190476191
CBM67	123	301	1.7e-28	0.9488636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.29e-97	443	841	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.87e-50	153	323	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.04e-21	331	439	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.71e-20	843	911	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR57809.1	2.00e-306	4	943	5	929
QQZ61197.1	1.55e-294	36	940	2	869
QLG40514.1	5.88e-289	59	940	1	848
QBD76857.1	1.59e-227	3	908	13	884
QUE54027.1	7.55e-220	122	901	4	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.26e-115	4	941	33	938	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	7.65e-114	9	945	12	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.05e-112	9	909	10	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.18e-130	6	929	39	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.25e-118	9	903	38	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	4.52e-113	9	940	12	1026	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	5.20e-94	12	942	41	947	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999831	0.000199	0.000008	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_04333.