CAZyme Information: MGYG000000176_04545

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_04545
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000000176_27|CGC1	88675.61	5.0023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 45293; End: 47608 Strand: -

Full Sequence      

MMTTTEKQNVIEEDIHAIYLGNLNTVEFNLDLPTKGKNGSVITWESSHEGILQPDGTVRR
PAYGMGNRKIELTATFTYGEVCKTQVYDITVLEEVKKDTIQKVYPLKVRVNKGKEYMLPA
YTVVDTEDGDTIVKEVQWDENRMHLFEYGGTYFFSGKVKDTKEAVTLEVQVLEESKADIC
NKEKKAISISDTEDAGNLILLEGSPYYEAQQNMHTYLKKQDLDQFLYSFREAAGLPVRQA
KPMRGWDSPEGLLRGHTTGHFLTALALAYHSTGEECFKEKADYLVEELQKCQEAFGRLEG
YQKGFLSAYSQEQFDLLEQYVTYPKIWAPYYTMHKILAGLIDSYRFTRNETALKVAEGLG
DWITARLKKLHPEQLEKMWSIYIAGEFGGINESLIWLYEYTGKTEYIETARLFDNEKLLL
PLENHIDALSGIHANQHIPQIIGMLKRFDATKEAPDYERAAFFWDVVTRFHSYSIGGVGE
AEMFHARNRIGGLLTDSTAESCASYNMLKLTKMLYEYEPRADYMDYYERTVLNHIVPGLD
KKKTGESTYFFPLKAGAKREFLFENSCCHGTGMESHSKYLDSAYFYGDETLYINQFIPSK
ILWDKGGYEIVQYGESNHPEKIVLEISRLSKESARPIIKRVKLRKPDWCQGEVKLKVNQE
IQVAEEQEGYIVADLCFEQGTVGLELEYPCGLHIRTTPDVPELTTLFYGPYVLAAVTDEL
EHIHVKKGDKPLETLWKRDGEELVFHCQGYSFIPLYQIDEQSYQVYFVMEY

Enzyme Prediction     

No EC number prediction in MGYG000000176_04545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	201	714	6.3e-166	0.9920477137176938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.67e-121	204	714	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.64e-75	207	715	20	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07532	Big_4	0.008	105	161	3	59	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM13425.1	1.62e-242	9	767	7	753
AWY98728.1	1.91e-227	10	767	12	752
QOS77131.1	4.35e-219	6	766	6	761
AIQ17696.1	1.67e-213	1	767	1	756
ASR47498.1	2.39e-213	8	767	14	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.99e-72	199	767	33	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.95e-66	199	767	33	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5HO0_A	6.73e-09	8	96	553	643	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]
5HO9_A	1.02e-08	8	92	553	637	Structureof truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus],5HO9_B Structure of truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_04545.