CAZyme Information: MGYG000000176_04749

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_04749
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36649.29	4.9044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 28535; End: 29536 Strand: -

Full Sequence      

MKLKALIIASSGMFVLIFSLLLFVVVLFSDEEDGGGSHIQYGGVNVSAEVLAHKPMLEKY
AREYGIEEYINVLLAIIQVESGGTLEDVMQSSESLGLPPNSLSTEESIKQGCKYFSELLA
SAEAKGCDLNTVIQSYNYGGGFLDYVSSRGKKYTFELAESFARDKSGGTKVTYTNPIAVE
KNGGWRYNYGNMFYVLVVSQYLTVAQFDDETVQAIMDEALKYEGWRYVFGGASPTTSFDC
SGLVQWCFGKAGISMPRTAQEQYNVTQHIPLSEAKAGDLVFFHSTYNAGTYITHVGIYQG
NNHMFHAGDPIGYADLTSSYWQQHLASAGRISK

Enzyme Prediction     

No EC number prediction in MGYG000000176_04749.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	2.68e-79	47	202	1	165	Lysozyme-like.
cd16891	CwlT-like	1.29e-73	53	202	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	4.57e-37	224	330	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	7.84e-30	211	331	365	481	invasion associated endopeptidase.
COG0791	Spr	9.73e-29	211	328	74	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUP84595.1	8.06e-203	1	333	1	334
QPK98675.1	1.15e-202	1	333	1	334
QJU16353.1	6.61e-202	1	333	1	334
QNM02071.1	6.61e-202	1	333	1	334
AJP13109.1	9.39e-202	1	333	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	8.44e-163	43	333	17	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.74e-156	37	331	13	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	2.33e-15	224	331	26	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
2K1G_A	2.98e-15	215	331	9	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
2EVR_A	4.73e-14	205	333	98	239	ChainA, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_A Chain A, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_B Chain B, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	2.44e-77	40	331	47	328	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	8.73e-22	53	200	55	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P21171	9.29e-22	215	331	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	4.99e-21	215	331	412	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	5.33e-21	214	331	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998227	0.001612	0.000070	0.000009	0.000005	0.000095

TMHMM  Annotations     

start	end
7	29